DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59b and Or67c

DIOPT Version :9

Sequence 1:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster


Alignment Length:403 Identity:81/403 - (20%)
Similarity:149/403 - (36%) Gaps:68/403 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NIYLYRAMWLIGWIPPKEGVLRYVYLFWTCVPFAFGVFYLPVGFIISYVQEFKNFTPGEFLTSLQ 86
            :||.:|:      ..|.:.:|..:||:...:.|..    |.:|.::.:....::|.......::.
  Fly    29 DIYAHRS------TNPLKSLLFKIYLYAGFINFNL----LVIGELVFFYNSIQDFETIRLAIAVA 83

  Fly    87 VCINVYGASVKSTITYLFLWRLRKTEI-LLDSLD----KRLAND-----SDRERIHNMVARCNYA 141
            .||   |.|:.:......:.|.:||.| |||.|:    |.||..     .|.|:....|..    
  Fly    84 PCI---GFSLVADFKQAAMIRGKKTLIMLLDDLENMHPKTLAKQMEYKLPDFEKTMKRVIN---- 141

  Fly   142 FLIYSFIYCGYAGS-------------TFLSYALSGRP-PWSVYNPFIDWRDGMGSLWIQ----A 188
              |::|:...|..:             .||.|....|. .:.::.||...|:.: ..||.    |
  Fly   142 --IFTFLCLAYTTTFSFYPAIKASVKFNFLGYDTFDRNFGFLIWFPFDATRNNL-IYWIMYWDIA 203

  Fly   189 IFEYITMSFAVLQDQLSDTYPLMFTIMFRAHMEVLKDHVRSLRMDPERSEADNYQDLVNCVLDHK 253
            ...|:.....:..|.|.........:.|......|:||..:...|.|     |.:.|:..:..|.
  Fly   204 HGAYLAGIAFLCADLLLVVVITQICMHFNYISMRLEDHPCNSNEDKE-----NIEFLIGIIRYHD 263

  Fly   254 TILKCCDMIRPMISRTIFVQFAL-------IGSVLGLTLVNVFFFSNFWKGVASLLFVITILLQT 311
            ..||.|:.:..:.|.::.:.|.:       |...:..:.|.|.        :...:|::|.::|.
  Fly   264 KCLKLCEHVNDLYSFSLLLNFLMASMQICFIAFQVTESTVEVI--------IIYCIFLMTSMVQV 320

  Fly   312 FPFCYTCNMLIDDAQDLSNEIFQSNWVDAEPRYKATLVLFMHHVQQPIIFIAGGIFPISMNSNIT 376
            |..||..:.||..:..:.:..:...|......|...|.|.:...|:|.........|||:.:.:.
  Fly   321 FMVCYYGDTLIAASLKVGDAAYNQKWFQCSKSYCTMLKLLIMRSQKPASIRPPTFPPISLVTYMK 385

  Fly   377 VAKFAFSIITIVR 389
            |...::....::|
  Fly   386 VISMSYQFFALLR 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 69/339 (20%)
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 68/327 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465935
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.