DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59b and Or49b

DIOPT Version :9

Sequence 1:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster


Alignment Length:361 Identity:59/361 - (16%)
Similarity:134/361 - (37%) Gaps:73/361 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 VCINVYGASVKSTITY-----------------LFLW--RLRKTEILLDSLDKRLA--------- 123
            |||.:....:.:.|.|                 |.||  .:.:..:||...|:.||         
  Fly    30 VCIGLASFHIFTQIVYMMSTNEGLTGIIRNSYMLVLWINTVLRAYLLLADHDRYLALIQKLTEAY 94

  Fly   124 ------NDS------DR-ERIHNMVARCNYAFLIYSFIYCGYAGSTFLSYALSGR---------- 165
                  |||      |: .::..::||.|..|.:.:.:..|.       |.||..          
  Fly    95 YDLLNLNDSYISEILDQVNKVGKLMARGNLFFGMLTSMGFGL-------YPLSSSERVLPFGSKI 152

  Fly   166 PPWSVY-NPFIDWRDGMGSLWIQAIFEYITMSFAVLQDQLSDTYPLMFTIMFR-AHMEVLKDHVR 228
            |..:.| :|:.:       :|.  ||:.:........ .:..|..::..|||. ...:.|:..:|
  Fly   153 PGLNEYESPYYE-------MWY--IFQMLITPMGCCM-YIPYTSLIVGLIMFGIVRCKALQHRLR 207

  Fly   229 SLRMD---PERSEADNYQDLVNCVLDHKTILKCCDMIRPMISRTIFVQFALIGSVLGLTLVNVFF 290
            .:.:.   .:|...:..::::.|:...::|::..|.|..:.:.....:.....::|...|..:..
  Fly   208 QVALKHPYGDRDPRELREEIIACIRYQQSIIEYMDHINELTTMMFLFELMAFSALLCALLFMLII 272

  Fly   291 FSNFWKGVASLLFVITILLQTFPFCYTCNMLIDDAQDLSNEIFQSNWVDAEPRYKATLVLFMHHV 355
            .|...:.:...:::..||.|.....:..|.|.:....::...:::.|...:...:..::..|...
  Fly   273 VSGTSQLIIVCMYINMILAQILALYWYANELREQNLAVATAAYETEWFTFDVPLRKNILFMMMRA 337

  Fly   356 QQPIIFIAGGIFPISMNSNITVAKFAFSIITIVRQM 391
            |:|...:.|.|.||::.....:....::..|:::::
  Fly   338 QRPAAILLGNIRPITLELFQNLLNTTYTFFTVLKRV 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 58/350 (17%)
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 53/327 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465781
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.