DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59b and Or43b

DIOPT Version :9

Sequence 1:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_523656.2 Gene:Or43b / 35743 FlyBaseID:FBgn0026393 Length:403 Species:Drosophila melanogaster


Alignment Length:398 Identity:138/398 - (34%)
Similarity:228/398 - (57%) Gaps:9/398 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FKLIKPAPLTEKVQSRQGNIYLYRAMWLIGW-IPPKEGVLRYVYLFWTCVPFAFGVFYLPVGFII 67
            |||:.|||::|.:|||..|.|:...:...|. :....|:.|.:   |....|.:.:..|||.|.|
  Fly     5 FKLVYPAPISEPIQSRDSNAYMMETLRNSGLNLKNDFGIGRKI---WRVFSFTYNMVILPVSFPI 66

  Fly    68 SYVQEFKNFTPGEFLTSLQVCINVYGASVKSTITYLFLWRLRKTEILLDSLDKRLANDSDRERIH 132
            :||.....|.|...|.|||:|:|.:..::|.....::..||.......|.|||.....:::.::.
  Fly    67 NYVIHLAEFPPELLLQSLQLCLNTWCFALKFFTLIVYTHRLELANKHFDELDKYCVKPAEKRKVR 131

  Fly   133 NMVARCNYAFLIYSFIYCGYAGSTFLSYALSGRPPWSVYNPFIDWRDGMGSLWIQAIFEYITMSF 197
            :|||.....:|.:..:|..||.||.|...|..|.|::.|.|||:||.....::||:..||.|:.:
  Fly   132 DMVATITRLYLTFVVVYVLYATSTLLDGLLHHRVPYNTYYPFINWRVDRTQMYIQSFLEYFTVGY 196

  Fly   198 AVLQDQLSDTYPLMFTIMFRAHMEVLKDHVRSLRMDPERSEADN----YQDLVNCVLDHKTILKC 258
            |:.....:|:||:::....|.|:.:|||.:..|. ||....:.:    ::.||:|:..|:|:|..
  Fly   197 AIYVATATDSYPVIYVAALRTHILLLKDRIIYLG-DPSNEGSSDPSYMFKSLVDCIKAHRTMLNF 260

  Fly   259 CDMIRPMISRTIFVQFALIGSVLGLTLVNVFFFSNFWKGVASLLFVITILLQTFPFCYTCNMLID 323
            ||.|:|:||.|||.||.:.||:||:.::|:..|::.......:::|:.:||||||.|:.||.::|
  Fly   261 CDAIQPIISGTIFAQFIICGSILGIIMINMVLFADQSTRFGIVIYVMAVLLQTFPLCFYCNAIVD 325

  Fly   324 DAQDLSNEIFQSNWVDAEPRYKATLVLFMHHVQQPIIFIAGGIFPISMNSNITVAKFAFSIITIV 388
            |.::|::.:|.|.|...:.||:.|::.|:..:|||:.|.|..||.|::.:||.||||||::..|.
  Fly   326 DCKELAHALFHSAWWVQDKRYQRTVIQFLQKLQQPMTFTAMNIFNINLATNINVAKFAFTVYAIA 390

  Fly   389 RQMNLAEQ 396
            ..|||.::
  Fly   391 SGMNLDQK 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 107/308 (35%)
Or43bNP_523656.2 7tm_6 95..384 CDD:251636 100/289 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468562
Domainoid 1 1.000 64 1.000 Domainoid score I17159
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I7489
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D31412at7147
OrthoFinder 1 1.000 - - FOG0003850
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.