DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59b and Or33c

DIOPT Version :9

Sequence 1:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster


Alignment Length:408 Identity:96/408 - (23%)
Similarity:170/408 - (41%) Gaps:76/408 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NIYLYRAMWL-IGWIPP------KEGVLRYVYL------FWTCVPFAFGVFYLPVGFIISYVQEF 73
            ::..||..|: :..:.|      ...|..||.|      .|..:.....:..||     |..:.|
  Fly     6 SLSFYRPFWICMRLLVPTFFKDSSRPVQLYVVLLHILVTLWFPLHLLLHLLLLP-----STAEFF 65

  Fly    74 KNFTPGEFLTSLQVCINVYGASVKSTITYLFLWRLRKTEILLDSLDKRLANDSD----RERIH-- 132
            ||      ||....|:   ..|:|.......|.::.:.|.|::.||..:|::.:    |:.:|  
  Fly    66 KN------LTMSLTCV---ACSLKHVAHLYHLPQIVEIESLIEQLDTFIASEQEHRYYRDHVHCH 121

  Fly   133 -NMVARCNYAFLIYSFIYCGYAGSTFLSYALSGRPPWSV----YNPFIDWRDGMGSLWIQAI--- 189
             ....||.|  :.:..||..:....|:. .:||.  |.:    |.||    |...:.::.|:   
  Fly   122 ARRFTRCLY--ISFGMIYALFLFGVFVQ-VISGN--WELLYPAYFPF----DLESNRFLGAVALG 177

  Fly   190 FEYITMSFAVLQDQLSDTYPLMFTIMFRAHMEVLKDHVRSLRM------DPERSEADNYQDLVNC 248
            ::..:|.....|...:|||..:...:...|:     |:.|:||      |.|  ...|:|.|::.
  Fly   178 YQVFSMLVEGFQGLGNDTYTPLTLCLLAGHV-----HLWSIRMGQLGYFDDE--TVVNHQRLLDY 235

  Fly   249 VLDHKTILKCCDMIRPMISRTIF-VQFALIGSVLGLTLVNVFFFSNFWKG-----VASLLFVITI 307
            :..||.:::    ...::||||. ||...:|. .|.||..:..:..|:.|     |..|:|...:
  Fly   236 IEQHKLLVR----FHNLVSRTISEVQLVQLGG-CGATLCIIVSYMLFFVGDTISLVYYLVFFGVV 295

  Fly   308 LLQTFPFCYTCNMLIDDAQDLSNEIFQSNWVDAEPRYKATLVLFMHHV--QQPIIFIAGGIFPIS 370
            .:|.||.||..:.:.::.:.|...||.|.|.|....::..|::|....  .:..|..|||:..::
  Fly   296 CVQLFPSCYFASEVAEELERLPYAIFSSRWYDQSRDHRFDLLIFTQLTLGNRGWIIKAGGLIELN 360

  Fly   371 MNSNITVAKFAFSIITIV 388
            :|:.....|.|:|:..:|
  Fly   361 LNAFFATLKMAYSLFAVV 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 78/332 (23%)
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 82/341 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468616
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.