DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59b and Or33a

DIOPT Version :9

Sequence 1:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_523553.1 Gene:Or33a / 34601 FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster


Alignment Length:394 Identity:99/394 - (25%)
Similarity:174/394 - (44%) Gaps:48/394 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KVQSRQGNIYLYRAMWLIGWIPPKEGVLRYVYLFWTCVPF---AFGVFYLPVGFIIS-----YVQ 71
            ||:|..    ||:..||...:...||    .|.|...|.|   :|.....||..|:.     .:|
  Fly     6 KVRSEN----LYKTYWLYWRLLGVEG----DYPFRRLVDFTITSFITILFPVHLILGMYKKPQIQ 62

  Fly    72 EFKNFTPGEFLTSLQVCINVYGASVKSTITYLFLWRLR--KT-EILLDSLDKRLANDSDR----- 128
            .|::.   .|.:....|         |...:.|.|:|:  || |.||..||.|:.::.:|     
  Fly    63 VFRSL---HFTSECLFC---------SYKFFCFRWKLKEIKTIEGLLQDLDSRVESEEERNYFNQ 115

  Fly   129 --ERIHNMVARCNYAFLIYSFIYCGYAG--STFLSYALSGRPPWSVYNPFIDWRDGMGSLWIQAI 189
              .|:..|:::......|.:.|....||  ||..:....|   |..|    |::......||...
  Fly   116 NPSRVARMLSKSYLVAAISAIITATVAGLFSTGRNLMYLG---WFPY----DFQATAAIYWISFS 173

  Fly   190 FEYITMSFAVLQDQLSDTYPLMFTIMFRAHMEVLKDHVRSLRMDPERSEADNYQDLVNCVLDHKT 254
            ::.|..|..:|::..:|:||.:...:...|:.:|...:..:..|.:.|.::|.:.|:..:.||:.
  Fly   174 YQAIGSSLLILENLANDSYPPITFCVVSGHVRLLIMRLSRIGHDVKLSSSENTRKLIEGIQDHRK 238

  Fly   255 ILKCCDMIRPMISRTIFVQFALIGSVLGLTLVNVFFFS-NFWKGVASLLFVITILLQTFPFCYTC 318
            ::|...::|..:..:...||...|..:.:||:|:.||: |.:..:...:|...:|::.||.||..
  Fly   239 LMKIIRLLRSTLHLSQLGQFLSSGINISITLINILFFAENNFAMLYYAVFFAAMLIELFPSCYYG 303

  Fly   319 NMLIDDAQDLSNEIFQSNWVDAEPRYKATLVLFMHHVQQPIIFIAGGIFPISMNSNITVAKFAFS 383
            .::..:...|...||.|||:..:.||..:|::.|.....|:...||||..|.|::.....:.|:|
  Fly   304 ILMTMEFDKLPYAIFSSNWLKMDKRYNRSLIILMQLTLVPVNIKAGGIVGIDMSAFFATVRMAYS 368

  Fly   384 IITI 387
            ..|:
  Fly   369 FYTL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 77/317 (24%)
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 79/324 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468656
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm50671
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.