DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59b and Or22c

DIOPT Version :9

Sequence 1:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster


Alignment Length:382 Identity:73/382 - (19%)
Similarity:136/382 - (35%) Gaps:73/382 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 FAFGVFYLPVGFI--ISY--------VQEFKNFTPGEFLTSLQVCINVYGASVKSTITYLFLWRL 108
            |.|....:.||.:  :||        |...:.|.||   |:..||:             |.||..
  Fly    45 FVFAFAMVVVGAVGEVSYGCVHLDNLVVALEAFCPG---TTKAVCV-------------LKLWVF 93

  Fly   109 RKTEILLDSLDKRLAN---DSDRERIHNMVARCNYAFLIYSFIYCGYAGSTFLSYALS----GRP 166
            .::......|.:||..   :|.|:....|:..........|.:......:|..::.|.    |..
  Fly    94 FRSNRRWAELVQRLRAILWESRRQEAQRMLVGLATTANRLSLLLLSSGTATNAAFTLQPLIMGLY 158

  Fly   167 PWSVYNPFIDWRDGMGSLWIQAIFEYITMSFAVLQDQLSDTYPLM-------------------- 211
            .|.|..|      |...|    .|..|..||||.......||.|:                    
  Fly   159 RWIVQLP------GQTEL----PFNIILPSFAVQPGVFPLTYVLLTASGACTVFAFSFVDGFFIC 213

  Fly   212 --------FTIMFRAHMEVLKD-HVRSLRMDPERSEADNYQDLVNCVLDHKTILKCCDMIRPMIS 267
                    |.::.:....:..| |..|:.:..|...|:....|...|..|..|:..|..:....:
  Fly   214 SCLYICGAFRLVQQDIRRIFADLHGDSVDVFTEEMNAEVRHRLAQVVERHNAIIDFCTDLTRQFT 278

  Fly   268 RTIFVQFALIGSVLGLTLVNVFFFSNFWKGVASLLFVITILLQTFPFCYTCNMLIDDAQDLSNEI 332
            ..:.:.|.....||..|::::...::...|:..:.::|..|.|.|.:|:..|.:.:.:..:::.:
  Fly   279 VIVLMHFLSAAFVLCSTILDIMLNTSSLSGLTYICYIIAALTQLFLYCFGGNHVSESSAAVADVL 343

  Fly   333 FQSNWVDAEPRYKATLVLFMHHVQQPIIFIAGGIFPISMNSNITVAKFAFSIITIVR 389
            :...|...:.|.:..:::.:...|:... ||...|..|:.:..::...|.|.||:::
  Fly   344 YDMEWYKCDARTRKVILMILRRSQRAKT-IAVPFFTPSLPALRSILSTAGSYITLLK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 61/340 (18%)
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 63/349 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465105
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.