DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59b and Or22b

DIOPT Version :9

Sequence 1:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster


Alignment Length:395 Identity:166/395 - (42%)
Similarity:250/395 - (63%) Gaps:3/395 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FKLIKPAPLTEKVQSRQGNIYLYRAMWLIGWIPPKEGVLRYVYLFWTCVPFAFGVFYLPVGFIIS 68
            |..||..||:|:|:||...:||.|.||..||..|:.......|..|:..........||:...:.
  Fly     6 FPHIKEKPLSERVKSRDAFVYLDRVMWSFGWTVPENKRWDLHYKLWSTFVTLLIFILLPISVSVE 70

  Fly    69 YVQEFKNFTPGEFLTSLQVCINVYGASVKSTITYLFLWRLRKTEILLDSLDKRLANDSDRERIHN 133
            |:|.||.|:.||||:|:|:.:|:||:|.||.:|.:...:.::.::.||.||||...|.:|..:|.
  Fly    71 YIQRFKTFSAGEFLSSIQIGVNMYGSSFKSYLTMMGYKKRQEAKMSLDELDKRCVCDEERTIVHR 135

  Fly   134 MVARCNYAFLIYSFIYCGYAGSTFLSYALSGRPPWSVYNPFIDWRDGMGSLWIQAIFEYITMSFA 198
            .||..|:.::.|...|..:..|.|||:.:.....|.:|.|::|...   ..:|.:|.|.|...:|
  Fly   136 HVALGNFCYIFYHIAYTSFLISNFLSFIMKRIHAWRMYFPYVDPEK---QFYISSIAEVILRGWA 197

  Fly   199 VLQDQLSDTYPLMFTIMFRAHMEVLKDHVRSLRMDPERSEADNYQDLVNCVLDHKTILKCCDMIR 263
            |..|..:|..||:..::.|.|:.:||..:|:||.:|.|:|.:..::|.:||.||:.||...|.:|
  Fly   198 VFMDLCTDVCPLISMVIARCHITLLKQRLRNLRSEPGRTEDEYLKELADCVRDHRLILDYVDALR 262

  Fly   264 PMISRTIFVQFALIGSVLGLTLVNVFFFSNFWKGVASLLFVITILLQTFPFCYTCNMLIDDAQDL 328
            .:.|.||||||.|||.||||:::|:.|||....|||.:||:..:.:|||||||.|||::||.|::
  Fly   263 SVFSGTIFVQFLLIGIVLGLSMINIMFFSTLSTGVAVVLFMSCVSMQTFPFCYLCNMIMDDCQEM 327

  Fly   329 SNEIFQSNWVDAEPRYKATLVLFMHHVQQPIIFIAGGIFPISMNSNITVAKFAFSIITIVRQMNL 393
            ::.:|||:|..|:.|||:|||.|:|::|||||..|||:|||||.:|:.:.|.||:::|||:|.||
  Fly   328 ADSLFQSDWTSADRRYKSTLVYFLHNLQQPIILTAGGVFPISMQTNLNMVKLAFTVVTIVKQFNL 392

  Fly   394 AEQFQ 398
            ||:||
  Fly   393 AEKFQ 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 128/304 (42%)
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 128/302 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468545
Domainoid 1 1.000 64 1.000 Domainoid score I17159
eggNOG 1 0.900 - - E1_2C9X1
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I7489
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003850
OrthoInspector 1 1.000 - - otm50671
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.