DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59b and Or9a

DIOPT Version :9

Sequence 1:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster


Alignment Length:431 Identity:101/431 - (23%)
Similarity:168/431 - (38%) Gaps:89/431 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IKPAPLTEKVQSRQGNIYLYRAMWLIGWIPPKEGVLRYVYLFWTCVPFAFGVFYLPVGFIISYVQ 71
            :|.....||.||.:..|.:||.|.:..|.|.......:: .|.|..|..  :|.:|: |:.::  
  Fly     5 VKGKKQEEKDQSLRVQILVYRCMGIDLWSPTMANDRPWL-TFVTMGPLF--LFMVPM-FLAAH-- 63

  Fly    72 EFKNFTPGEFLTSLQVCINVYGASVKSTIT----YLFLWRLRKTEILLDSLDKRLANDSD----- 127
                    |::|.:.:..:..|::..|.:|    .||.:..::...|:..:...||.:.:     
  Fly    64 --------EYITQVSLLSDTLGSTFASMLTLVKFLLFCYHRKEFVGLIYHIRAILAKEIEVWPDA 120

  Fly   128 RERIHNMVARCNYAFLIYSFIYC-GYAG-----STFLSYALS--------------GRPPWSV-- 170
            ||.|.  |...:...|..::..| |.||     ..|:...||              |..|:.:  
  Fly   121 REIIE--VENQSDQMLSLTYTRCFGLAGIFAALKPFVGIILSSIRGDEIHLELPHNGVYPYDLQV 183

  Fly   171 ---YNPFIDWRDGMGSLWIQAIFEYITMSFAVLQDQLSDTYPLMFTIMFRAHMEVLKDHVRSLRM 232
               |.|...|.       :.|.:..:||:..|      |:....||....|..::.|..:..|  
  Fly   184 VMFYVPTYLWN-------VMASYSAVTMALCV------DSLLFFFTYNVCAIFKIAKHRMIHL-- 233

  Fly   233 DPERSEADNYQDLVNCVLDHKTILKCCDMIRPMISRTIFVQF---ALIGSVLGLTLVNVF----- 289
             |.....:..:.||..:|.|:..|:..|.|.......||:||   ||....:|..:.::|     
  Fly   234 -PAVGGKEELEGLVQVLLLHQKGLQIADHIADKYRPLIFLQFFLSALQICFIGFQVADLFPNPQS 297

  Fly   290 -FFSNFWKGVASLLFVITILLQTFPFCYT-CNMLIDDAQ-DLSNEIFQSNWVDAEPRYKATLVLF 351
             :|..|   |.|||..:        |.|: |...|..|. |..|.::::||.|..|..|..|::.
  Fly   298 LYFIAF---VGSLLIAL--------FIYSKCGENIKSASLDFGNGLYETNWTDFSPPTKRALLIA 351

  Fly   352 MHHVQQPIIFIAGGIFPISMNSNITVAKFAFSIITIVRQMN 392
            ....|:| ..:.|..|..||.:..|:.:.|.|.|.::|..|
  Fly   352 AMRAQRP-CQMKGYFFEASMATFSTIVRSAVSYIMMLRSFN 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 79/349 (23%)
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 77/342 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465589
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.