DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59b and Or82a

DIOPT Version :9

Sequence 1:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_730794.1 Gene:Or82a / 318778 FlyBaseID:FBgn0041621 Length:385 Species:Drosophila melanogaster


Alignment Length:372 Identity:77/372 - (20%)
Similarity:150/372 - (40%) Gaps:80/372 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IISYVQEFKNFTPGEFLTSLQVCINVYGASVKSTI---TYL--------FLWRLRKTEILLDSLD 119
            :||||...:|     .:..:..|::|...::.:.|   |:|        .:.|.||       :.
  Fly    47 LISYVAYNRN-----DMEKVTACLSVVFTNMLTVIKISTFLANRKDFWEMIHRFRK-------MH 99

  Fly   120 KRLANDSDRERIH-NMVARCNYAFLIYSFIYCGYAGSTFLSYALSGRP----------------- 166
            ::.|:...|.|.. :.||..|.........||...|.|.|.:.|.  |                 
  Fly   100 EQSASHIPRYREGLDYVAEANKLASFLGRAYCVSCGLTGLYFMLG--PIVKIGVCRWHGTTCDKE 162

  Fly   167 -PWSVYNPFIDWRDGMGSLWIQAIFEY------ITMSFAVLQDQLSDTYPLMFTIMFRAHMEVLK 224
             |..:..||.|    :.|...:..|.|      :.:::|...|.|.    :.|.|..|||.:.|:
  Fly   163 LPMPMKFPFND----LESPGYEVCFLYTVLVTVVVVAYASAVDGLF----ISFAINLRAHFQTLQ 219

  Fly   225 DHVRSLRMDPERSEADNYQDLVNCVLDHKTILKCCDMIRPMISRTIFVQFALIGSVLGL------ 283
            ..:.:...  ..||.|....|.:.|..|..:|.....:|.:.:.|:..||.:....:|:      
  Fly   220 RQIENWEF--PSSEPDTQIRLKSIVEYHVLLLSLSRKLRSIYTPTVMGQFVITSLQVGVIIYQLV 282

  Fly   284 ----TLVNVFFFSNFWKGVASLLFVITILLQTFPFCYTCNMLIDDAQDLSNEIFQSNWVDAEPRY 344
                :::::..:::|:.         :|:||.|.:||...::..::..:...:..|||..|.|:.
  Fly   283 TNMDSVMDLLLYASFFG---------SIMLQLFIYCYGGEIIKAESLQVDTAVRLSNWHLASPKT 338

  Fly   345 KATLVLFMHHVQQPIIFIAGGIFPISMNSNITVAKFAFSIITIVRQM 391
            :.:|.|.:...|:.:: |..|.|..|:.:.:.:.:.|.|:||:::.:
  Fly   339 RTSLSLIILQSQKEVL-IRAGFFVASLANFVGICRTALSLITLIKSI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 68/350 (19%)
Or82aNP_730794.1 7tm_6 65..374 CDD:251636 67/337 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465607
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.