DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpF and SK19

DIOPT Version :10

Sequence 1:NP_611796.1 Gene:SkpF / 37713 FlyBaseID:FBgn0034863 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_565295.1 Gene:SK19 / 814845 AraportID:AT2G03160 Length:200 Species:Arabidopsis thaliana


Alignment Length:73 Identity:16/73 - (21%)
Similarity:31/73 - (42%) Gaps:1/73 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 LIELVEAEQKMQQQQQTVRSTMGPRGTSNYGASSHRLAEESLLASSGSETSLD-DLSDVRPRLLQ 292
            |::.:|..:.|.|..:..|........:::.:||...:..:|:::.....:|. ..|......|.
plant    37 LLQSIEEARAMMQFTEYSRCRFWSSHPNSFCSSSSTSSFNALISALRCLLTLSIPRSQCSDNCLP 101

  Fly   293 GERKAKIP 300
            |.|||..|
plant   102 GFRKAPKP 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpFNP_611796.1 BTB_POZ_SKP1 3..126 CDD:349631
Skp1 112..157 CDD:460222
SK19NP_565295.1 BTB_POZ_SKP1 5..155 CDD:349631 16/73 (22%)
Skp1 141..187 CDD:460222
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.