DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SkpF and SkpA

DIOPT Version :9

Sequence 1:NP_611796.1 Gene:SkpF / 37713 FlyBaseID:FBgn0034863 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001033818.1 Gene:SkpA / 31016 FlyBaseID:FBgn0025637 Length:162 Species:Drosophila melanogaster


Alignment Length:161 Identity:97/161 - (60%)
Similarity:123/161 - (76%) Gaps:0/161 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPVIKLQSSDGEIFETDIETAKCSSTIKTLLEDCPVEAENDTLIPLPNVNSTILKKVLIWAKHHR 65
            ||.|||||||.|||:|||:.||||.||||:||||.:|.:.:.::||||||||||:|||.||.:|:
  Fly     1 MPSIKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENAIVPLPNVNSTILRKVLTWAHYHK 65

  Fly    66 EDIAEENEEEAAKSVAVQITPWDAEFLSMDQGTLFELILAANYLDIPNLLNAACMTVANMIKGRT 130
            :|.....::|:.:.....|..|||:||.:|||||||||||||||||..||...|.||||||||:|
  Fly    66 DDPQPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCKTVANMIKGKT 130

  Fly   131 TEEIRQTFHITNDFSPSEEDLMTMESEVPQE 161
            .||||:||:|..||||:||:.:..|:|..:|
  Fly   131 PEEIRKTFNIKKDFSPAEEEQVRKENEWCEE 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SkpFNP_611796.1 SKP1 1..157 CDD:227528 95/155 (61%)
Skp1 1..111 CDD:214704 67/109 (61%)
Skp1 87..157 CDD:279768 48/69 (70%)
SkpANP_001033818.1 BTB_POZ_SKP1 4..126 CDD:349631 74/121 (61%)
Skp1 112..159 CDD:396171 27/46 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452338
Domainoid 1 1.000 51 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5201
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1572
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412723at2759
OrthoFinder 1 1.000 - - FOG0000367
OrthoInspector 1 1.000 - - otm46619
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X346
109.900

Return to query results.
Submit another query.