DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59a and Or98b

DIOPT Version :9

Sequence 1:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster


Alignment Length:426 Identity:82/426 - (19%)
Similarity:164/426 - (38%) Gaps:112/426 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EFFKSHWTAWRYLGVAHFRVEN------WKNLYVFYSIVSNLLVTLCYPVHLGISLFRNRTITED 68
            :|.:.....:|.||:.....::      |:::....|:.|.:.:|:.:    |:...:|.....|
  Fly     5 KFLRLQSALFRLLGLELLHEQDVGHRYPWRSICCILSVASFMPLTIAF----GLQNVQNVEQLTD 65

  Fly    69 ILNLTTFATCTACSVKCLLYAYNIKD----------VLEMERLLRLLDERVVGPEQRSIYGQVRV 123
            .|..........|.:...|:.|  ||          ||:.|....:. |.:|..|.|      |.
  Fly    66 SLCSVLVDLLALCKIGLFLWLY--KDFKFLIGQFYCVLQTETHTAVA-EMIVTRESR------RD 121

  Fly   124 QLRNVLYV--FIGIYMPCALFAELSFLFKEER------GLMYPAWFPFDWLHSTRNY---YIANA 177
            |..:.:|.  ||...:...|.:.||.|...:|      ...:|:.:|:|.: ...||   |..|.
  Fly   122 QFISAMYAYCFITAGLSACLMSPLSMLISYQRTGELQPKFPFPSVYPWDNM-KLSNYIISYFWNV 185

  Fly   178 YQIVGISFQLLQNYVSDCFPAV----VLCLISSHIKMLYN-------RFEEVGLDPARDAEKDLE 231
            ...:|::           .|.|    :.|.:|.::..|:.       .||      .|:.::..|
  Fly   186 CAALGVA-----------LPTVCVDTLFCSLSHNLCALFQIARHKMMHFE------GRNTKETHE 233

  Fly   232 ACITDHKHILELFR---RIEAFIS---LPMLIQFTVTALNVCIGLAALVFFVSEPMARMYFIFYS 290
                :.||:.:|:.   .:..|::   .|::.||...:|::|:....|...:.:| |.:::..::
  Fly   234 ----NLKHVFQLYALCLNLGHFLNEYFRPLICQFVAASLHLCVLCYQLSANILQP-ALLFYAAFT 293

  Fly   291 LAMPLQIFPSCFFGTDNE---YWFGRLHYAAFSCNW-HTQNRSFKRKMMLFVEQSLKKSTAVAGG 351
            .|:..|:...||.|:...   ..||:   |.:..:| |            .::::|:..:::...
  Fly   294 AAVVGQVSIYCFCGSSIHSECQLFGQ---AIYESSWPH------------LLQENLQLVSSLKIA 343

  Fly   352 MMRIHL-------------DTFFSTLKGAYSLFTII 374
            |||..|             :|..:.::.|.|..|::
  Fly   344 MMRSSLGCPIDGYFFEANRETLITIVRTAISYVTLL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 69/358 (19%)
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 70/359 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.