DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59a and Or98a

DIOPT Version :9

Sequence 1:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster


Alignment Length:355 Identity:86/355 - (24%)
Similarity:155/355 - (43%) Gaps:27/355 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VFYSIVSNLLVTLC---YPVHLGISL---FRNRTITEDILNLTTFATCTACSVKCLLYAYNIKDV 95
            :.|.|.|.|:...|   .|:.:.||.   ....|..|.:..:..|........|.|.:...|...
  Fly    41 IIYYITSCLIFAWCAVYLPIGIIISFKTDINTFTPNELLTVMQLFFNSVGMPFKVLFFNLYISGF 105

  Fly    96 LEMERLLRLLDERVVGPEQR-SIY-GQVRVQLRNVLYVFIGIYMPCALFAELSFLFKEERGLMYP 158
            .:.::||..:|:|....::| .:: |.||.....::|.||......:.|...:...|    |.:.
  Fly   106 YKAKKLLSEMDKRCTTLKERVEVHQGVVRCNKAYLIYQFIYTAYTISTFLSAALSGK----LPWR 166

  Fly   159 AWFPF-DWLHSTRNYYIANAYQIVGISFQLLQNYVSDCFPAVVLCLISSHIKMLYNRFEEVGLDP 222
            .:.|| |:..|..:::.|...:...:.|.:.|..:||.:|.:...::..|:|:|..|.|.:..|.
  Fly   167 IYNPFVDFRESRSSFWKAALNETALMLFAVTQTLMSDIYPLLYGLILRVHLKLLRLRVESLCTDS 231

  Fly   223 AR-DA--EKDLEACITDHKHILELFRRIEAFISLPMLIQFTVTALNVCIGLAAL-VFFVSEPMAR 283
            .: ||  |:||..||.||..|::....|...::..:.:||.:  :.:|:||:.: :.|.::....
  Fly   232 GKSDAENEQDLIKCIKDHNLIIDYAAAIRPAVTRTIFVQFLL--IGICLGLSMINLLFFADIWTG 294

  Fly   284 MYFIFYSLAMPLQIFPSCF----FGTDNEYWFGRLHYAAFSCNWHTQNRSFKRKMMLFVEQSLKK 344
            :..:.|...:.:|.||.||    ...|.|.    |..|.|..||...:||:|..:..|::.:.|.
  Fly   295 LATVAYINGLMVQTFPFCFVCDLLKKDCEL----LVSAIFHSNWINSSRSYKSSLRYFLKNAQKS 355

  Fly   345 STAVAGGMMRIHLDTFFSTLKGAYSLFTII 374
            ....||.:..|...:.....|.|:|:.|.:
  Fly   356 IAFTAGSIFPISTGSNIKVAKLAFSVVTFV 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 75/314 (24%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 75/314 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468678
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.