DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59a and Or94b

DIOPT Version :9

Sequence 1:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster


Alignment Length:393 Identity:85/393 - (21%)
Similarity:155/393 - (39%) Gaps:60/393 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RYLGVAHFRVE------NW-KNLYVFYSIVSNLLVTLCYPVHLGISLFRNRTITED--------- 68
            |::|:..:..|      .| |.:|.|   |.:|.:|..|     |:|.....||..         
  Fly    18 RWIGLLKWENEGEDGVLTWLKRIYPF---VLHLPLTFTY-----IALMWYEAITSSDFEEAGQVL 74

  Fly    69 ILNLTTFATCTAC--------SVKCLLY------AYNIKDVLEMERLLRLLDERVVGPEQRSIYG 119
            .:::|..|..|..        ....|::      |:|:::                 .|:...:.
  Fly    75 YMSITELALVTKLLNIWYRRHEAASLIHELQHDPAFNLRN-----------------SEEIKFWQ 122

  Fly   120 QVRVQLRNVLYVFIGIYMPCALFAELSFLFKEERGLMYPAWFPFDWLHSTRNYYIANAYQIVGIS 184
            |.:...:.:.|.:|...:..|:...:|..|:|:..|.:..:.||:| .:...|:.|..|.:|.::
  Fly   123 QNQRNFKRIFYWYIWGSLFVAVMGYISVFFQEDYELPFGYYVPFEW-RTRERYFYAWGYNVVAMT 186

  Fly   185 FQLLQNYVSDCFPAVVLCLISSHIKMLYNRFEEVGLDPARDAEKDLEACITDHKHILELFRRIEA 249
            ...|.|.:.|......:..|:|..::|..|.|.:.......|..:|......|..:..|.|..|.
  Fly   187 LCCLSNILLDTLGCYFMFHIASLFRLLGMRLEALKNAAEEKARPELRRIFQLHTKVRRLTRECEV 251

  Fly   250 FISLPMLIQFTVTALNVCIGLAALVF--FVSEPMARMYFIFYSLAMPLQIFPSCFFGTDNEYWFG 312
            .:|..:|.|...:|..:|.....||.  |...|...:..:.:...|.:|||..|::|.:..:...
  Fly   252 LVSPYVLSQVVFSAFIICFSAYRLVHMGFKQRPGLFVTTVQFVAVMIVQIFLPCYYGNELTFHAN 316

  Fly   313 RLHYAAFSCNWHTQNRSFKRKMMLFVEQSLKKSTAV-AGGMMRIHLDTFFSTLKGAYSLFTIIIR 376
            .|..:.|..||...:...::.:..::| .||:...| ||....|.|..|..|:..|||.|.::::
  Fly   317 ALTNSVFGTNWLEYSVGTRKLLNCYME-FLKRPVKVRAGVFFEIGLPIFVKTINNAYSFFALLLK 380

  Fly   377 MRK 379
            :.|
  Fly   381 ISK 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 67/329 (20%)
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 65/324 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466040
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.