DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59a and Or94a

DIOPT Version :9

Sequence 1:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:381 Identity:79/381 - (20%)
Similarity:147/381 - (38%) Gaps:51/381 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 WRYLGVAHFRVENWKNLYVFYSIVSNLLVTLCYPVHLGISLFRNRTITEDILNLTTFATCTACSV 83
            |.:.|   |...|       |..:.:|.:|..:...:.:..|.:..:.:....|....|..|..|
  Fly    34 WTFTG---FVKRN-------YRFLLHLPITFTFIGLMWLEAFISSNLEQAGQVLYMSITEMALVV 88

  Fly    84 KCL-LYAYNIKDVLEMERLLRLLDERVVGPEQRSIYGQVRVQLRNVLYVFIGIYMPCALFAELSF 147
            |.| ::.|..:....|..|....|.::...|:...:.:.:...:...|::|.|.:..........
  Fly    89 KILSIWHYRTEAWRLMYELQHAPDYQLHNQEEVDFWRREQRFFKWFFYIYILISLGVVYSGCTGV 153

  Fly   148 LFKEERGLMYPAWFPFDWLHSTRNYYIANAYQIVGISFQLLQNYVSDCFPAVVLCLISSHIKMLY 212
            ||.|...|.:..:.||:| .:.|.|:.|..|.:.|::...:.|...|    .:.|....||.:||
  Fly   154 LFLEGYELPFAYYVPFEW-QNERRYWFAYGYDMAGMTLTCISNITLD----TLGCYFLFHISLLY 213

  Fly   213 NRFEEVGLDPARDAEKD------LEACITDHKHILELFRRIEAFISLPMLIQFTVTALNVC---- 267
             |...:.|...::.:.|      |.|....|:.|..|....:..:|..:|.|..::||.:|    
  Fly   214 -RLLGLRLRETKNMKNDTIFGQQLRAIFIMHQRIRSLTLTCQRIVSPYILSQIILSALIICFSGY 277

  Fly   268 ----IGL-------AALVFFVSEPMARMYFIFYSLAMPLQIFPSCFFGTDNEYWFGRLHYAAFSC 321
                :|:       .:::.|||             .|.|||:..|::|.:...:..:|....:..
  Fly   278 RLQHVGIRDNPGQFISMLQFVS-------------VMILQIYLPCYYGNEITVYANQLTNEVYHT 329

  Fly   322 NWHTQNRSFKRKMMLFVEQSLKKSTAVAGGMMRIHLDTFFSTLKGAYSLFTIIIRM 377
            ||.......::.:..::|...|..|..||....:.|..|..|:..|||...:::.:
  Fly   330 NWLECRPPIRKLLNAYMEHLKKPVTIRAGNFFAVGLPIFVKTINNAYSFLALLLNV 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 68/325 (21%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 68/325 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466039
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.