DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59a and Or85e

DIOPT Version :9

Sequence 1:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster


Alignment Length:408 Identity:84/408 - (20%)
Similarity:137/408 - (33%) Gaps:107/408 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VHLGISLFRNRTITEDILNLTTFATCTACSVKCLLYAY----NIKDVLEMERLLRLLDERVVGPE 113
            :|||: ||...|:  |:|........|......::|.:    .|...|...|||..::.......
  Fly    75 LHLGV-LFTKTTL--DVLPTGELQAITDALTMTIIYFFTGYGTIYWCLRSRRLLAYMEHMNREYR 136

  Fly   114 QRSIYGQVRV-------QLRNVLYVFIGIYMPCALFA---ELSFLFKEERGLMYPAWFPFDWLHS 168
            ..|:.|...|       ..||...|:|   |.|.|..   .:|.|....|.|....|:|||.| .
  Fly   137 HHSLAGVTFVSSHAAFRMSRNFTVVWI---MSCLLGVISWGVSPLMLGIRMLPLQCWYPFDAL-G 197

  Fly   169 TRNYYIANAYQI-----VGISFQLLQNYVSDCFPAVVLCL-------------ISSHIKMLYNRF 215
            ...|....|.|:     ||::|    .:....|..:.|.|             :.:|.|:|..  
  Fly   198 PGTYTAVYATQLFGQIMVGMTF----GFGGSLFVTLSLLLLGQFDVLYCSLKNLDAHTKLLGG-- 256

  Fly   216 EEV-GLDPAR------DAEKDLEACITDHKHILELFRRIEAFISLPMLIQFTVTALNVCIGLAAL 273
            |.| ||...:      |::::|...:...:|..:|. |:.|....|........||..||.|...
  Fly   257 ESVNGLSSLQEELLLGDSKRELNQYVLLQEHPTDLL-RLSAGRKCPDQGNAFHNALVECIRLHRF 320

  Fly   274 VFFVSEPMARMYFIFYSLAMPLQI-FPSC---FFG------------------------------ 304
            :...|:.:..: |..|.|...||| |..|   |.|                              
  Fly   321 ILHCSQELENL-FSPYCLVKSLQITFQLCLLVFVGVSGTREVLRIVNQLQYLGLTIFELLMFTYC 384

  Fly   305 ----------TDNEYWFGRLHYAAFSCNWHTQNRSFKRKMMLFVEQSLKKSTAVAGGMMRIHLDT 359
                      :.:.:|.|.         |.......::.:::|:..|.:.....||....:.::.
  Fly   385 GELLSRHSIRSGDAFWRGA---------WWKHAHFIRQDILIFLVNSRRAVHVTAGKFYVMDVNR 440

  Fly   360 FFSTLKGAYSLFTIIIRM 377
            ..|.:..|:|..|::.::
  Fly   441 LRSVITQAFSFLTLLQKL 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 76/386 (20%)
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 69/349 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.