DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59a and Or85b

DIOPT Version :9

Sequence 1:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster


Alignment Length:408 Identity:79/408 - (19%)
Similarity:149/408 - (36%) Gaps:110/408 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FRVENWKN------------LYVFYSIVSN----LLVTLCYP--VHLGIS--------------- 58
            |.:..|.|            :||:.:.:.|    .:..|.|.  |.:|:|               
  Fly    33 FHIVFWSNVINLSFVGLFESIYVYSAFMDNKFLEAVTALSYIGFVTVGMSKMFFIRWKKTAITEL 97

  Fly    59 ------LFRNRTITEDILNLTTF-ATCTACSV------KCLLYAYNIKDVLEMERLLRLLDERVV 110
                  ::.|..|.|:..||..: .||:..|:      ..|::.:|:..|:|.....:.|:.|||
  Fly    98 INELKEIYPNGLIREERYNLPMYLGTCSRISLIYSLLYSVLIWTFNLFCVMEYWVYDKWLNIRVV 162

  Fly   111 GPEQRSIYGQVRVQLRNVLYVFIGIYMPCALFAELSFLFKEERGLMYPAWFPFDWLHSTRNYYIA 175
            |.:                                         |.|..:.|:.|..:...|.:.
  Fly   163 GKQ-----------------------------------------LPYLMYIPWKWQDNWSYYPLL 186

  Fly   176 NAYQIVGISFQLLQNYVSDCFPAVVLCLISS----HIKMLYNRFEEVGLDPARDAEKD---LEAC 233
            .:....|.:     :........|:||.:::    |...|.|..|...|  :.|.:||   |...
  Fly   187 FSQNFAGYT-----SAAGQISTDVLLCAVATQLVMHFDFLSNSMERHEL--SGDWKKDSRFLVDI 244

  Fly   234 ITDHKHILELFRRIEAFISLPMLIQFTVTALNVC-IGLAALVFFVSEPMARMYFIFYSLAMPLQI 297
            :..|:.||.|...:.....:|:|:.|.|::..:| :|....|....:.:.:: |:|...:|. |:
  Fly   245 VRYHERILRLSDAVNDIFGIPLLLNFMVSSFVICFVGFQMTVGVPPDIVVKL-FLFLVSSMS-QV 307

  Fly   298 FPSCFFG---TDNEYWFGRLHYAAFSCNWHTQNRSFKRKMMLFVEQSLKKSTAVAGGMMRIHLDT 359
            :..|.:|   .|..|.|.   .|.::..|:..:..:||.:::.:.:|.|.:...|...:.|...|
  Fly   308 YLICHYGQLVADASYGFS---VATYNQKWYKADVRYKRALVIIIARSQKVTFLKATIFLDITRST 369

  Fly   360 FFSTLKGAYSLFTIIIRM 377
            ....|:.:|..|.::..|
  Fly   370 MTDLLQISYKFFALLRTM 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 64/321 (20%)
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 70/366 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465808
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.