DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59a and Or59c

DIOPT Version :9

Sequence 1:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster


Alignment Length:362 Identity:86/362 - (23%)
Similarity:166/362 - (45%) Gaps:29/362 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WKNLYVFYSIVSNLLVTLCYPVHLGISL-----FRNRTITEDILNLTTFATCTACSVK-CLLYAY 90
            |  :|..:::.:..|..:..|  ||:||     |...|.||.:.:|.....|....:| |:.|: 
  Fly    46 W--IYSLWTLTTMWLGIVYLP--LGLSLTYVKHFDRFTPTEFLTSLQVDINCIGNVIKSCVTYS- 105

  Fly    91 NIKDVLEMERLLRLLDERVVGPEQRSIYGQVRVQLRNVLYVFIGIYMP-C--ALFAELSFLFKEE 152
            .:.....|..|:..||:|.|...||.|:.::..::..::.:|:..|:. |  .||..: |..|..
  Fly   106 QMWRFRRMNELISSLDKRCVTTTQRRIFHKMVARVNLIVILFLSTYLGFCFLTLFTSV-FAGKAP 169

  Fly   153 RGLMYPAWFPFDWLHSTRNYYIANAYQIVGISFQLLQNYVSDCFPAVVLCLISSHIKMLYNRFEE 217
            ..|..|.   .||.......:||:..:...:|...:|..:||.:..|.:.|...|:.:|.:|...
  Fly   170 WQLYNPL---VDWRKGHWQLWIASILEYCVVSIGTMQELMSDTYAIVFISLFRCHLAILRDRIAN 231

  Fly   218 VGLDPARDAEKDLE---ACITDHKHILELFRRIEAFISLPMLIQFTVTALNVCIGLAALVFFVSE 279
            :..||.....:..|   |||.||:.|::..:.|...:|:.:..||.:..:::.:...:::||.:.
  Fly   232 LRQDPKLSEMEHYEQMVACIQDHRTIIQCSQIIRPILSITIFAQFMLVGIDLGLAAISILFFPNT 296

  Fly   280 PMARMYFIFYSLAMPLQIFPSCFFG----TDNEYWFGRLHYAAFSCNWHTQNRSFKRKMMLFVEQ 340
            ....|..:.:.:|:..:.||.|...    .|:.:    :..|.|..||.|.:||:|..::.|:.:
  Fly   297 IWTIMANVSFIVAICTESFPCCMLCEHLIEDSVH----VSNALFHSNWITADRSYKSAVLYFLHR 357

  Fly   341 SLKKSTAVAGGMMRIHLDTFFSTLKGAYSLFTIIIRM 377
            :.:.....||.:..|.:.:..:..|.|:::.||:.:|
  Fly   358 AQQPIQFTAGSIFPISVQSNIAVAKFAFTIITIVNQM 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 73/314 (23%)
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 73/314 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468681
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.