DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59a and Or59b

DIOPT Version :9

Sequence 1:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster


Alignment Length:404 Identity:101/404 - (25%)
Similarity:173/404 - (42%) Gaps:62/404 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RVDSLEFFKSHW-TAW--------RYLGVAHFRVENWKNLYVFYSIVSNLLVTLCYPVHLGISL- 59
            |..::..:::.| ..|        ||             :|:|::.|.........||...||. 
  Fly    19 RQGNIYLYRAMWLIGWIPPKEGVLRY-------------VYLFWTCVPFAFGVFYLPVGFIISYV 70

  Fly    60 --FRNRTITEDILNLTTFATCTACSVKCLLYAYNIKDVLEMERLLRLLDERVVGPEQRS-IYGQV 121
              |:|.|..|.:.:|.........|||..:....:..:.:.|.||..||:|:.....|. |:..|
  Fly    71 QEFKNFTPGEFLTSLQVCINVYGASVKSTITYLFLWRLRKTEILLDSLDKRLANDSDRERIHNMV 135

  Fly   122 -RVQLRNVLYVFIGIYMPCALFAELSFLFKEERGLMYPAWF---PF-DWLHSTRNYYIANAYQIV 181
             |.....::|.|  ||  |. :|..:||.....|  .|.|.   || ||.....:.:|...::.:
  Fly   136 ARCNYAFLIYSF--IY--CG-YAGSTFLSYALSG--RPPWSVYNPFIDWRDGMGSLWIQAIFEYI 193

  Fly   182 GISFQLLQNYVSDCFPAVVLCLISSHIKMLYNRFEEVGLDPAR---DAEKDLEACITDHKHILEL 243
            .:||.:||:.:||.:|.:...:..:|:::|.:....:.:||.|   |..:||..|:.|||.||:.
  Fly   194 TMSFAVLQDQLSDTYPLMFTIMFRAHMEVLKDHVRSLRMDPERSEADNYQDLVNCVLDHKTILKC 258

  Fly   244 FRRIEAFISLPMLIQFTVTALNVCIGLAAL-VFFVSEPMARMYFIFYSLAMPLQIFPSCFF---- 303
            ...|...||..:.:||.:  :...:||..: |||.|.....:..:.:.:.:.||.||.|:.    
  Fly   259 CDMIRPMISRTIFVQFAL--IGSVLGLTLVNVFFFSNFWKGVASLLFVITILLQTFPFCYTCNML 321

  Fly   304 -----GTDNEYWFGRLHYAAFSCNWHTQNRSFKRKMMLFVEQSLKKSTAVAGGMMRIHLDTFFST 363
                 ...||         .|..||......:|..::||:....:....:|||:..|.:::..:.
  Fly   322 IDDAQDLSNE---------IFQSNWVDAEPRYKATLVLFMHHVQQPIIFIAGGIFPISMNSNITV 377

  Fly   364 LKGAYSLFTIIIRM 377
            .|.|:|:.||:.:|
  Fly   378 AKFAFSIITIVRQM 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 82/322 (25%)
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 82/322 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468686
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9588
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.