DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59a and Or56a

DIOPT Version :9

Sequence 1:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:280 Identity:54/280 - (19%)
Similarity:114/280 - (40%) Gaps:60/280 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 VFIGIYMPCALFAELSFLFKEERGLMYPAWFPFDWLHSTRNY---YIANAYQI-VGI-SFQLLQN 190
            ::..:::|.::|...:....||..::....|||..|  ..|:   |:...|.: :|| :..|...
  Fly   158 IYRSLFLPKSVFNVPAVRRGEEHPILLFQLFPFGEL--CDNFVVGYLGPWYALGLGITAIPLWHT 220

  Fly   191 YVSDCFPAVVLCL---ISSHIKMLYNRFEEVGLDP-------ARDAEKDL--------EACITDH 237
            :::        ||   ::..:::|..|.||:.:..       .|....:|        :..:.:.
  Fly   221 FIT--------CLMKYVNLKLQILNKRVEEMDITRLNSKLVIGRLTASELTFWQMQLFKEFVKEQ 277

  Fly   238 KHILELFRRIEAFISLPMLIQFTVTALNVCIGLAALVFFVSEPMARMYFIFYSLAMP--LQIFPS 300
            ..|.:..:.::..|.:|::..|.:.::.:|....||...|...|...:...|...|.  |.|:  
  Fly   278 LRIRKFVQELQYLICVPVMADFIIFSVLICFLFFALTVGVPSKMDYFFMFIYLFVMAGILWIY-- 340

  Fly   301 CFFGTDNEYWFG--------RLHYAAFSCNWHTQNRSFK---RKMMLFVEQSLKKSTAVAGGMMR 354
                    :|..        .|..|.|||.|:    :|:   :||::|:....::...:...::.
  Fly   341 --------HWHATLIVECHDELSLAYFSCGWY----NFEMPLQKMLVFMMMHAQRPMKMRALLVD 393

  Fly   355 IHLDTFFSTLKGAYSLFTII 374
            ::|.||....:||||.|.::
  Fly   394 LNLRTFIDIGRGAYSYFNLL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 50/272 (18%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 50/272 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.