DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59a and Or49b

DIOPT Version :9

Sequence 1:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster


Alignment Length:245 Identity:52/245 - (21%)
Similarity:95/245 - (38%) Gaps:58/245 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 YPAWFPFDWLHSTRN--YYIANAYQIVG-ISFQLLQNYVSDCFPAVVLCLISSHIKMLYNRFEEV 218
            |..|:.|..|.:...  .||.....||| |.|            .:|.|      |.|.:|..:|
  Fly   163 YEMWYIFQMLITPMGCCMYIPYTSLIVGLIMF------------GIVRC------KALQHRLRQV 209

  Fly   219 GL-------DPARDAEKDLEACITDHKHILELFRRIEAFISLPMLIQFTVTALNVCIGLAALVFF 276
            .|       || |:..:::.|||...:.|:|....|....::..|.:....:..:|    ||:|.
  Fly   210 ALKHPYGDRDP-RELREEIIACIRYQQSIIEYMDHINELTTMMFLFELMAFSALLC----ALLFM 269

  Fly   277 V------SEPMARMYFIFYSLAMPLQIFPSCFFGTDNEYWFGR--------LHYAAFSCNWHTQN 327
            :      |:.:....:|...||..|.:           ||:..        :..||:...|.|.:
  Fly   270 LIIVSGTSQLIIVCMYINMILAQILAL-----------YWYANELREQNLAVATAAYETEWFTFD 323

  Fly   328 RSFKRKMMLFVEQSLKKSTAVAGGMMRIHLDTFFSTLKGAYSLFTIIIRM 377
            ...::.::..:.::.:.:..:.|.:..|.|:.|.:.|...|:.||::.|:
  Fly   324 VPLRKNILFMMMRAQRPAAILLGNIRPITLELFQNLLNTTYTFFTVLKRV 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 48/234 (21%)
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 48/234 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465751
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.