DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59a and Or49a

DIOPT Version :9

Sequence 1:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:440 Identity:83/440 - (18%)
Similarity:151/440 - (34%) Gaps:128/440 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEVRVDSLEFFKSH----WTAWRYLGVAHF-----------------RVENWKN---------- 34
            ||.:...:|.:...|    |  ||||.|..:                 |:..|::          
  Fly    13 MANMMFKTLGYDLFHTPKPW--WRYLLVRGYFVLCTISNFYEASMVTTRIIEWESLAGSPSKIMR 75

  Fly    35 --LYVFYSIVSNLLVTLCYPVHLGISLFRNRTITEDILNLTTFATCTACSVKCLLYAYNIKDVLE 97
              |:.||.:.|.|                                      |.:.:..|.|.:|:
  Fly    76 QGLHFFYMLSSQL--------------------------------------KFITFMINRKRLLQ 102

  Fly    98 MERLLRLL----DERVVGPEQRSIYGQVRVQLRNVLYVFIGIYMPCAL-------------FAEL 145
            :...|:.|    ::.....|....|  :....||||||:..:.:..||             |.:.
  Fly   103 LSHRLKELYPHKEQNQRKYEVNKYY--LSCSTRNVLYVYYFVMVVMALEPLVQSCIMYLIGFGKA 165

  Fly   146 SFLFKEERGLMYPAWFPFDWLHSTRNYYIANAYQIVGISFQLLQNYVSDCFPAVVLCLISSHIKM 210
            .|.:|.    ::|....|| ......|.:|.........|.:..:..:|.:...|...||.|:..
  Fly   166 DFTYKR----IFPTRLTFD-SEKPLGYVLAYVIDFTYSQFIVNVSLGTDLWMMCVSSQISMHLGY 225

  Fly   211 LYNRFEEVGLDPARDAEKD---LEACITDHKHILELFRRIEAFISLPMLIQ-FTVTALNVCI--- 268
            |.|....:...|..: ::|   |.:.|..|:.::.|.:.:.....|.:... ||.:.|..|:   
  Fly   226 LANMLASIRPSPETE-QQDCDFLASIIKRHQLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMAYY 289

  Fly   269 ---------GLAALVFFVSEPMARMYFIFYSLAMPLQIFPSCFFGTDNEYWFGRLHYAAFSCNWH 324
                     |::.::.|.|  :|..:::..|....|....:            .|..|||...|:
  Fly   290 TVVEGFNWEGISYMMLFAS--VAAQFYVVSSHGQMLIDLST------------NLAKAAFESKWY 340

  Fly   325 TQNRSFKRKMMLFVEQSLKKSTAVAGGMMRIHLDTFFSTLKGAYSLFTII 374
            ..:..:|:::::.:.|:.:.....|.|::.|.||||...:...|..|.:|
  Fly   341 EGSLRYKKEILILMAQAQRPLEISARGVIIISLDTFKILMTITYRFFAVI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 63/336 (19%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 64/355 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465813
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.