DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59a and Or45b

DIOPT Version :9

Sequence 1:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster


Alignment Length:410 Identity:81/410 - (19%)
Similarity:159/410 - (38%) Gaps:87/410 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FFKSHWTAWRYLGVAHFRVENWKNLYVFYSIVSNLLVTLCYPVHLGISLFRNRTITEDILNLTTF 75
            ||.:.: ::..||:...:.::|  |::.:.:.:.:.:..|............||...|.::    
  Fly    17 FFVTRY-SFGLLGLRFGKEQSW--LHLLWLVFNFVNLAHCCQAEFVFGWSHLRTSPVDAMD---- 74

  Fly    76 ATC-TACSVKCLL-------YAYNIKDVLEMERLL------RLLDERVVGPEQRSIY-------- 118
            |.| .|||...|.       ....:.|:::..|||      |....|.|.  |||.|        
  Fly    75 AFCPLACSFTTLFKLGWMWWRRQEVADLMDRIRLLIGEQEKREDSRRKVA--QRSYYLMVTRCGM 137

  Fly   119 -----GQVRV---QLRNVLYVFIGIYMPCALFAELSFLFKEERGLMYPAWFPFDWLHSTRNYYIA 175
                 |.:..   .||::..:::..:...........||.:....|  .|||..:|:||.:..: 
  Fly   138 LVFTLGSITTGAFVLRSLWEMWVRRHQEFKFDMPFRMLFHDFAHRM--PWFPVFYLYSTWSGQV- 199

  Fly   176 NAYQIVG-----ISFQLLQNYVSDCFPAVVLCLISSHIKMLYNRFE-EVGLDPARDAE-KDLEAC 233
            ..|...|     ..|.|   |::....|:              |:: :..|.|.||.. ::.:.|
  Fly   200 TVYAFAGTDGFFFGFTL---YMAFLLQAL--------------RYDIQDALKPIRDPSLRESKIC 247

  Fly   234 ------ITD-HKHILELFRRIEAFISLPMLIQFTVTALNVCIGLAALVFFVSEPMARMYFIFYSL 291
                  |.| |..|.::.:.....::.|..:.|...:|.:...:..::.:....:.|  ::.|:.
  Fly   248 CQRLADIVDRHNEIEKIVKEFSGIMAAPTFVHFVSASLVIATSVIDILLYSGYNIIR--YVVYTF 310

  Fly   292 AMPLQIFPSCFFGTDNEYWFGRLHYAAFSCNWHTQNRSFKRKMMLFVEQSLKKSTAVAGGMMRIH 356
            .:...||..|:.||:.......|..||:|..|:|.:|..:|::.|.:.::.:..|      :|: 
  Fly   311 TVSSAIFLYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLIILRAQRPIT------VRV- 368

  Fly   357 LDTFFSTLKGAYSLFTIIIR 376
              .||:.   :..:||.:|:
  Fly   369 --PFFAP---SLPVFTSVIK 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 70/347 (20%)
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 72/356 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465131
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.