DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59a and Or42b

DIOPT Version :9

Sequence 1:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster


Alignment Length:385 Identity:89/385 - (23%)
Similarity:174/385 - (45%) Gaps:42/385 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 WTAWRYLGVAHFRVENW--------KNLYVFYSIVSNLLVTLCYPV-HLGISLFRNRTIT--EDI 69
            :.|.:::|        |        :.:|:.:::::.:..|...|: .||..:.:.::.:  |.:
  Fly    25 YRAMKFIG--------WLPPKQGVLRYVYLTWTLMTFVWCTTYLPLGFLGSYMTQIKSFSPGEFL 81

  Fly    70 LNLTTFATCTACSVKCLLYAYNIKDVLEMERLLRLLDERVVGPEQRSIYGQVRVQLRNVLYVFIG 134
            .:|.........|||..:....:..:::.:.:|..||.|....|:|.....|..:..:...:|..
  Fly    82 TSLQVCINAYGSSVKVAITYSMLWRLIKAKNILDQLDLRCTAMEEREKIHLVVARSNHAFLIFTF 146

  Fly   135 IYMPCALFAELSFLFKEERGLMYPAW---FPF-DWLHSTRNYYIANAYQIVGISFQLLQNYVSDC 195
            :|  |. :|..::|.....|  .|.|   .|| ||...|...::|:..:.:.:|..:||:.:||.
  Fly   147 VY--CG-YAGSTYLSSVLSG--RPPWQLYNPFIDWHDGTLKLWVASTLEYMVMSGAVLQDQLSDS 206

  Fly   196 FPAVVLCLISSHIKMLYNRFEEVGLDP-ARDAE--KDLEACITDHKHILELFRRIEAFISLPMLI 257
            :|.:...::.:|:.||..|...:..|. ..:||  ::|..|:.|||.||.....|:..|...:..
  Fly   207 YPLIYTLILRAHLDMLRERIRRLRSDENLSEAESYEELVKCVMDHKLILRYCAIIKPVIQGTIFT 271

  Fly   258 QFTVTALNVCIGLAAL-VFFVSEPMARMYFIFYSLAMPLQIFPSCF----FGTDNEYWFGRLHYA 317
            ||.:  :.:.:|...: |||.|:....:....:.:.:.||.||.|:    ...|.|    .|.:|
  Fly   272 QFLL--IGLVLGFTLINVFFFSDIWTGIASFMFVITILLQTFPFCYTCNLIMEDCE----SLTHA 330

  Fly   318 AFSCNWHTQNRSFKRKMMLFVEQSLKKSTAVAGGMMRIHLDTFFSTLKGAYSLFTIIIRM 377
            .|..||...:|.:|..::.|::...:....:|||:.:|.:.:..|..|.|:|:.||..:|
  Fly   331 IFQSNWVDASRRYKTTLLYFLQNVQQPIVFIAGGIFQISMSSNISVAKFAFSVITITKQM 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 76/317 (24%)
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 76/315 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468679
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9588
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.