DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59a and Or24a

DIOPT Version :9

Sequence 1:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster


Alignment Length:386 Identity:69/386 - (17%)
Similarity:145/386 - (37%) Gaps:80/386 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LYVFYSIVSNLLVTLCY----------PVHLGISLFRNRTITEDILNLTTFATCTACSVKCLLYA 89
            |:.|::..  :|...||          |:::..:|.....:...||:|...       |....|.
  Fly    41 LWSFFNFF--ILTYGCYAEAYYGIHYIPINIATALDALCPVASSILSLVKM-------VAIWWYQ 96

  Fly    90 YNIKDVLEMERLL--RLLDERVVGPEQRSIYGQVRVQLRNVLYVFIGIYMPCALFAELSF----- 147
            ..::.::|..|.|  :...:|.:|.::|  :..:..||..:|       :.|......|:     
  Fly    97 DELRSLIERVRFLTEQQKSKRKLGYKKR--FYTLATQLTFLL-------LCCGFCTSTSYSVRHL 152

  Fly   148 ---LFKEERG----------LMYP------AWFPFDWLHSTRNYYIANAYQIVGISFQLLQNYVS 193
               :.:...|          :|:|      ..:|..::....:.||.....:....|     ::.
  Fly   153 IDNILRRTHGKDWIYETPFKMMFPDLLLRLPLYPITYILVHWHGYITVVCFVGADGF-----FLG 212

  Fly   194 DC--FPAVVLCLISSHIKMLYNRFEEVGLDPARDAE----KDLEACITDHKHILELFRRIEAFIS 252
            .|  |..::|||......:|  ..|.:...|:...|    :::|..:..|..:.||..|:...:.
  Fly   213 FCLYFTVLLLCLQDDVCDLL--EVENIEKSPSEAEEARIVREMEKLVDRHNEVAELTERLSGVMV 275

  Fly   253 LPMLIQFTVTALNVCIGLAALVFFVSEPMARMYFIFYSLAMPLQIFPSCFFGTDNEYWFGRLHYA 317
            ...|..|..::|  .||.:.:...:...:..:.::.|:.|:.::||..|..|:........|..:
  Fly   276 EITLAHFVTSSL--IIGTSVVDILLFSGLGIIVYVVYTCAVGVEIFLYCLGGSHIMEACSNLARS 338

  Fly   318 AFSCNWHTQNRSFKRKMMLFVEQSLKKSTAVAGGMMRI-----HLDTFFSTLKGAYSLFTI 373
            .||.:|:..:...::..:|.|.::.:..|      ::|     .|:|..|.|:...||..:
  Fly   339 TFSSHWYGHSVRVQKMTLLMVARAQRVLT------IKIPFFSPSLETLTSILRFTGSLIAL 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 60/340 (18%)
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 61/350 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465149
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.