DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59a and Or9a

DIOPT Version :9

Sequence 1:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster


Alignment Length:359 Identity:77/359 - (21%)
Similarity:136/359 - (37%) Gaps:89/359 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 TITEDILNLTTFATCTACSVKCLLYAYNIKDVLEMERLLR--LLDERVVGPEQRSIYGQVRVQLR 126
            ::..|.|. :|||:.... ||.||:.|:.|:.:.:...:|  |..|..|.|:.|.|. :|..|..
  Fly    70 SLLSDTLG-STFASMLTL-VKFLLFCYHRKEFVGLIYHIRAILAKEIEVWPDAREII-EVENQSD 131

  Fly   127 NVLYVFIGIYMPC----ALFAEL----SFLFKEERG------LMYPAWFPFDWLHSTRNYYIANA 177
            .:|.:   .|..|    .:||.|    ..:....||      |.:...:|:|.  ....:|:...
  Fly   132 QMLSL---TYTRCFGLAGIFAALKPFVGIILSSIRGDEIHLELPHNGVYPYDL--QVVMFYVPTY 191

  Fly   178 YQIVGISFQLLQNYVSDCFPAVVLCLISSHIKMLYN--------RFEEVGLDPARDAEKDLEAC- 233
            ...|..|:..:         .:.||:.|......||        :...:.| ||...:::||.. 
  Fly   192 LWNVMASYSAV---------TMALCVDSLLFFFTYNVCAIFKIAKHRMIHL-PAVGGKEELEGLV 246

  Fly   234 -----------ITDHKHILELFRRIEAFISLPMLIQFTVTALNVC-IGLAALVFFVSEPMARMYF 286
                       |.|  ||.:.:|.:       :.:||.::||.:| ||......| ..|.: :||
  Fly   247 QVLLLHQKGLQIAD--HIADKYRPL-------IFLQFFLSALQICFIGFQVADLF-PNPQS-LYF 300

  Fly   287 IFY--SLAMPLQIFPSC---------FFGTDNEYWFGRLHYAAFSCNWHTQNRSFKRKMMLFVEQ 340
            |.:  ||.:.|.|:..|         .||.           ..:..||...:...||.:::...:
  Fly   301 IAFVGSLLIALFIYSKCGENIKSASLDFGN-----------GLYETNWTDFSPPTKRALLIAAMR 354

  Fly   341 SLKKSTAVAGGMMRIHLDTFFSTLKGAYSLFTII 374
            : ::...:.|......:.||.:.::.|.|...::
  Fly   355 A-QRPCQMKGYFFEASMATFSTIVRSAVSYIMML 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 75/351 (21%)
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 75/351 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465579
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.