DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59a and Or65a

DIOPT Version :9

Sequence 1:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_729161.1 Gene:Or65a / 318011 FlyBaseID:FBgn0041625 Length:417 Species:Drosophila melanogaster


Alignment Length:405 Identity:91/405 - (22%)
Similarity:147/405 - (36%) Gaps:105/405 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AWRYLGVAHFRVENWKNLYVFYSI-VSNLLVTLCYP--------VHLGISLFRNRTITEDILNLT 73
            ||:|                |.|| ::..|.:|.|.        |:||..|....||......|.
  Fly    65 AWQY----------------FVSIQLATALASLFYGISESIGDIVNLGRDLVFIITIIFICFRLV 113

  Fly    74 TFATCTACSVKCLLYAYNIKDVLEMERLLRLLDERVVGPEQRSIYGQVRVQLRNVLYVFIGIYMP 138
            .||.          ||..: ||: ::.|..:....:.||..:.:....|:.    ..:|:.:.:.
  Fly   114 FFAQ----------YAGEL-DVI-IDALEDIYHWSIKGPATKEVQETKRLH----FLLFMALIIT 162

  Fly   139 CALFAELSFLFK-------EERGLMYPAWFPFDWLHSTRNYYIANAYQIVGISFQLLQNY----- 191
            ...|..|..|.|       |.:.|.:...:||. ||....:.|  ||.|:.:|......|     
  Fly   163 WFSFLILFMLIKISTPFWIESQTLPFHVSWPFQ-LHDPSKHPI--AYIIIFVSQSTTMLYFLIWL 224

  Fly   192 -------VSDCFPAV----VLCLISSHIK--------MLYNRFEEVGLDPARDAEKDLEACITDH 237
                   ||..|...    |||:...:::        |||               ::|......|
  Fly   225 GVVENMGVSLFFELTSALRVLCIELRNLQELCLGDEDMLY---------------RELCRMTKFH 274

  Fly   238 KHILELFRRIE-----AFISLPMLIQFTVTALNVCIGLAALVFFVSEPMARMYFIFYSLAMPLQI 297
            :.|:.|..|..     ||| :.|||.|.:.:|::...|||.   .:..:|..|.|...:.:....
  Fly   275 QQIILLTDRCNHIFNGAFI-MQMLINFLLVSLSLFEVLAAK---KNPQVAVEYMIIMLMTLGHLS 335

  Fly   298 FPSCF---FGTDNEYWFGRLHYAAFSCNWHTQNRSFKRKMMLFVEQSLKKSTAVAGGMMRIHLDT 359
            |.|.|   |..::|. .....|.|:..|  ..::|..|:...|::::.|.....|......:|:.
  Fly   336 FWSKFGDMFSKESEQ-VALAVYEAYDPN--VGSKSIHRQFCFFIQRAQKPLIMKASPFPPFNLEN 397

  Fly   360 FFSTLKGAYSLFTII 374
            :...||..||:.||:
  Fly   398 YMFILKQCYSILTIL 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 74/342 (22%)
Or65aNP_729161.1 7tm_6 145..406 CDD:251636 62/289 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465239
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.