DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59a and Or7a

DIOPT Version :9

Sequence 1:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_511081.1 Gene:Or7a / 31750 FlyBaseID:FBgn0030016 Length:413 Species:Drosophila melanogaster


Alignment Length:366 Identity:92/366 - (25%)
Similarity:163/366 - (44%) Gaps:34/366 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WKNLYVFYSIVSNLLVTLCYPVHLGISLFR---NRTITEDILNLTTFATCTACSVKCLLYAYNIK 93
            |:.:|..:|:|..:...|..|....|| :|   ...||:.:.:............|.:..|:|:.
  Fly    46 WQRIYACFSVVMYVWQLLLVPTFFVIS-YRYMGGMEITQVLTSAQVAIDAVILPAKIVALAWNLP 109

  Fly    94 DVLEMERLLRLLDERVVGPEQRSIYGQVRVQLRNVLYVFIGIYMPC-ALFAELSFLFKEERGL-M 156
            .:...|..|..||.|....|:..:.... |:..|.|..|   |..| |:::..:|:.....|. .
  Fly   110 LLRRAEHHLAALDARCREQEEFQLILDA-VRFCNYLVWF---YQICYAIYSSSTFVCAFLLGQPP 170

  Fly   157 YPAWFP-FDWLHSTRNYYIANAYQIVGISFQLLQNYVSDCFPAVVLCLISSHIKMLYNRFEEVGL 220
            |..:.| .||..|...:.|....:.:.:::..|.....|.:..:.|.::...:::|..|.|::|.
  Fly   171 YALYLPGLDWQRSQMQFCIQAWIEFLIMNWTCLHQASDDVYAVIYLYVVRIQVQLLARRVEKLGT 235

  Fly   221 DPARDAE------------KDLEACITDHKHILELFRRIEAFISLPMLIQFTVTALNVCIGLAAL 273
            |.:...|            .:|:.||.||:.:|:|...|...||..:.:||.:||  ..:|...:
  Fly   236 DDSGQVEIYPDERRQEEHCAELQRCIVDHQTMLQLLDCISPVISRTIFVQFLITA--AIMGTTMI 298

  Fly   274 -VFFVSEPMARMYFIFYSLAMPLQIFPSCFFGT----DNEYWFGRLHYAAFSCNWHTQNRSFKRK 333
             :|..:....::..|.|.||:.||..|.|:..|    |||    ||..|.|.|.|..|:..|::.
  Fly   299 NIFIFANTNTKIASIIYLLAVTLQTAPCCYQATSLMLDNE----RLALAIFQCQWLGQSARFRKM 359

  Fly   334 MMLFVEQSLKKSTAVAGGMMRIHLDTFFSTLKGAYSLFTII 374
            ::.::.::.:..|..|..:..|:|.|:||..|.::||:|:|
  Fly   360 LLYYLHRAQQPITLTAMKLFPINLATYFSIAKFSFSLYTLI 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 79/323 (24%)
Or7aNP_511081.1 7tm_6 80..394 CDD:251636 79/323 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468684
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.