DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or59a and Or69a

DIOPT Version :9

Sequence 1:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:362 Identity:75/362 - (20%)
Similarity:139/362 - (38%) Gaps:78/362 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SIVSNLLVTLCYPVHLG--ISLFRNRTITEDILNLTTFATCTACSVKCLLYAYNIKDVLEMERLL 102
            |:.|.|..|:...::|.  :||   :|..|::||                         |.|.|.
  Fly    79 SVASMLGFTIVGTLNLWKMLSL---KTHFENLLN-------------------------EFEELF 115

  Fly   103 RLLDERVVGPEQRSIYGQVRVQLRNVLYVFI-----GIY---MPCALFAELSFLFKEERG--LMY 157
            :|:..|..     .|:.......|::...||     .:|   :|..|.....|...::.|  :..
  Fly   116 QLIKHRAY-----RIHHYQEKYTRHIRNTFIFHTSAVVYYNSLPILLMIREHFSNSQQLGYRIQS 175

  Fly   158 PAWFPFDWLHSTRNYYIANAYQI--------VGISFQLLQNYVSDCFPAVVLCLISSHIKMLYNR 214
            ..|:|:....|...::.|.|.||        |.:..|.|.|:..        ..:..|...|..:
  Fly   176 NTWYPWQVQGSIPGFFAAVACQIFSCQTNMCVNMFIQFLINFFG--------IQLEIHFDGLARQ 232

  Fly   215 FEEVGLDPARD--AEKDLEACITDHKHILELFRRIEAFISLPMLIQFTVTALNVCIGLAALVFF- 276
            .|.:   .||:  |:..|:..|..|..:|.|..|:....:...||..:|:.::.|....::..| 
  Fly   233 LETI---DARNPHAKDQLKYLIVYHTKLLNLADRVNRSFNFTFLISLSVSMISNCFLAFSMTMFD 294

  Fly   277 ----VSEPMARMYFIFYSLAMPLQIFPSCFFGTDNEYWFGRLHYAAFSCNWHTQNRSFKRKMMLF 337
                :...:..:.||.|:.:|       |..||......|::..|||..||:..:..::|.:::.
  Fly   295 FGTSLKHLLGLLLFITYNFSM-------CRSGTHLILTSGKVLPAAFYNNWYEGDLVYRRMLLIL 352

  Fly   338 VEQSLKKSTAVAGGMMRIHLDTFFSTLKGAYSLFTII 374
            :.::.|........:..:.:.|:.:|||.:|.:||.:
  Fly   353 MMRATKPYMWKTYKLAPVSITTYMATLKFSYQMFTCV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 65/328 (20%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 72/354 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465807
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.