DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3530 and Mtmr11

DIOPT Version :9

Sequence 1:NP_726322.1 Gene:CG3530 / 37707 FlyBaseID:FBgn0028497 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001178025.1 Gene:Mtmr11 / 689613 RGDID:1589965 Length:700 Species:Rattus norvegicus


Alignment Length:369 Identity:104/369 - (28%)
Similarity:160/369 - (43%) Gaps:84/369 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 WTLCSMNEKYELCDTYPRQIYVPKEATTLMLISSSRFR------SKGRLPVLTYLHNNKASICRC 274
            |.:..:||::::..:.....:||..      |..|..|      .:||.|.|::.|...:.:.||
  Rat   219 WRVSMVNERFDVATSLSGYFWVPNR------ILDSEVRRAFAHFHQGRGPRLSWHHPGGSDLLRC 277

  Fly   275 SQPLSGF---SARCLED----EQMLEAIRKTNSNTDYMYVVDTRPRINAMANRAAGKGYENEAFY 332
                :||   |....||    |.||:|     .::| :.:|||...:.::|:             
  Rat   278 ----AGFYIASDPNKEDIRAVELMLQA-----GHSD-VVLVDTMDEMPSLAD------------- 319

  Fly   333 ENIKFHFLGIENIHVQRASLQKVLEACEQKSPTMSAFINALESSGWLKHIRSILDTSSFIANAVD 397
                          ||.|.|:.........|.....:::|||.:.||.::||.|..:|.|:..|.
  Rat   320 --------------VQLAHLKLRALCLPDSSVAEDKWLSALEGTRWLDYVRSCLRKASDISVLVT 370

  Fly   398 KGV-SVVVHCSDGWDRTAQVCSLAQLMLNPYYRTIKGFQALIEKDWLAFGHKFSERCGHIQTDAR 461
            ..| |||:......|....:.||.||:|.|..||:.|||:|::::|:|.||.|..|.|  :|.|.
  Rat   371 SRVRSVVLQERGDRDFNGLLSSLVQLLLAPEARTLFGFQSLVQREWVAAGHPFLTRLG--ETGAS 433

  Fly   462 EVSPIFTQFLDCTWQLMSQRSEAFEFNERFLLILHDHVHSCQFGTFVGNCEKDR----------- 515
            |.:|:...||||.|||:.|....|||:|.|||.|||.:......||:.|...:|           
  Rat   434 EEAPVLPLFLDCAWQLLQQFPAEFEFSEFFLLALHDSIRVPDTLTFLRNTPWERGKKSGQFNSYT 498

  Fly   516 ----------LDLKLAERTFSLWG----YMANHLNEYINPLYKP 545
                      |....|....|:|.    |....:::::||.|.|
  Rat   499 QVYTPEYSQPLAGSPANLHLSVWDWDLRYSKEQISQFLNPGYDP 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3530NP_726322.1 PH-GRAM_MTMR6-like 78..173 CDD:270030
Myotub-related 179..514 CDD:284109 94/311 (30%)
FYVE_MTMR_unchar 693..753 CDD:277277
Mtmr11NP_001178025.1 PH-like 51..165 CDD:302622
PTPc 195..469 CDD:304379 89/294 (30%)
3-PAP 553..683 CDD:289355
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349486
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1089
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.