DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2Bdelta and EIF2B2

DIOPT Version :9

Sequence 1:NP_611790.1 Gene:eIF2Bdelta / 37706 FlyBaseID:FBgn0034858 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_055054.1 Gene:EIF2B2 / 8892 HGNCID:3258 Length:351 Species:Homo sapiens


Alignment Length:307 Identity:82/307 - (26%)
Similarity:136/307 - (44%) Gaps:58/307 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 RLGVQYAKRTVVGSNARCIAFLHALRQVVHDFETPAKKEFGR---SLDAAVKHHVDHLHKCRPLA 374
            |:.......|.||:..|.:  |..:|:           |:||   ..|.:.:.  :.|||    .
Human    67 RMTAAQPSETTVGNMVRRV--LKIIRE-----------EYGRLHGRSDESDQQ--ESLHK----L 112

  Fly   375 VSVSNAYKQFKNQLTQLPADVPETESKELLVHFIDTYIENQIGKAAQAISGFLQEKITDGDVLLT 439
            ::.....:.|.....||.:::.|. ..||||....| :||   .||||:     |.|...:|::|
Human   113 LTSGGLNEDFSFHYAQLQSNIIEA-INELLVELEGT-MEN---IAAQAL-----EHIHSNEVIMT 167

  Fly   440 FACSSLIQFICEEAKRRQVAFRVIVVDSRPGCEGQELLRRLHATGIPCTYVLINAVGYVMAEATK 504
            ...|..::...:||.|:: .|.|||.:..|.|:|.|:...|...||..|.:...|:..||:...|
Human   168 IGFSRTVEAFLKEAARKR-KFHVIVAECAPFCQGHEMAVNLSKAGIETTVMTDAAIFAVMSRVNK 231

  Fly   505 VLLGAHALLANGYVMARTGTAQVALVANAHNVPVLVCCETHKFSERFQTDAIVYNELSDPNQLV- 568
            |::|...:||||.:.|.|||..:||.|..|:.|::||....|.|.:|..:...:::...|.::: 
Human   232 VIIGTKTILANGALRAVTGTHTLALAAKHHSTPLIVCAPMFKLSPQFPNEEDSFHKFVAPEEVLP 296

  Fly   569 --RGD-------KCQLSNWAAKGKLLPLNLSYDITPPELVSAVVTEV 606
              .||       .|.:               :|..||||::..::.:
Human   297 FTEGDILEKVSVHCPV---------------FDYVPPELITLFISNI 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2BdeltaNP_611790.1 GCD2 306..619 CDD:224105 82/307 (27%)
IF-2B 323..611 CDD:279362 80/297 (27%)
EIF2B2NP_055054.1 IF-2B 29..333 CDD:395798 82/307 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.