DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2Bdelta and GCN3

DIOPT Version :9

Sequence 1:NP_611790.1 Gene:eIF2Bdelta / 37706 FlyBaseID:FBgn0034858 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_012951.1 Gene:GCN3 / 853896 SGDID:S000001734 Length:305 Species:Saccharomyces cerevisiae


Alignment Length:295 Identity:71/295 - (24%)
Similarity:129/295 - (43%) Gaps:34/295 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 IAFLHALRQVVHDFETPAKKEFGRSLDAAVKHHVDHLHKCRPLAVSV---SNAYKQFKNQLTQLP 392
            ||.:.||..::. .:||   |....:...:|...:.|.|..|.:||:   .:.:.:|..:...|.
Yeast    24 IAAIEALVTLLR-IKTP---ETAAEMINTIKSSTEELIKSIPNSVSLRAGCDIFMRFVLRNLHLY 84

  Fly   393 ADVPETESKELLVHFIDT--YIENQIGKAAQAISGFLQEKITDGDVLLTFACSSLIQFICEEAKR 455
            .|....:.     |.|:.  ...::..|:...|:....:.|.|.|::|....|..:..:...|..
Yeast    85 GDWENCKQ-----HLIENGQLFVSRAKKSRNKIAEIGVDFIADDDIILVHGYSRAVFSLLNHAAN 144

  Fly   456 RQVAFRVIVVDSRPGCEGQELLRRLHATGIPCTYVLINAVGYVMAEATKVLLGAHALLANGYVMA 520
            :.:.||.:|.:|||..:|.:|...|...|||.|.::.:|||.|:.:..||.:||..:..:|.::.
Yeast   145 KFIRFRCVVTESRPSKQGNQLYTLLEQKGIPVTLIVDSAVGAVIDKVDKVFVGAEGVAESGGIIN 209

  Fly   521 RTGTAQVALVANAHNVPVLVCCETHKFSERFQTDAIVYNELSDPNQLVRGDKCQLSNW------A 579
            ..||..|.::|:....|..|..|:|||...|        .||..:..:.|.....:..      |
Yeast   210 LVGTYSVGVLAHNARKPFYVVTESHKFVRMF--------PLSSDDLPMAGPPLDFTRRTDDLEDA 266

  Fly   580 AKGKLLPLNLSYDITPPELVSAVVTEVAILPCTSV 614
            .:|..:      |.|..|.::|::|::.:|..::|
Yeast   267 LRGPTI------DYTAQEYITALITDLGVLTPSAV 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2BdeltaNP_611790.1 GCD2 306..619 CDD:224105 71/295 (24%)
IF-2B 323..611 CDD:279362 70/290 (24%)
GCN3NP_012951.1 GCD2 1..304 CDD:224105 71/295 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.