DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2Bdelta and eIF2Balpha

DIOPT Version :9

Sequence 1:NP_611790.1 Gene:eIF2Bdelta / 37706 FlyBaseID:FBgn0034858 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_651752.1 Gene:eIF2Balpha / 43549 FlyBaseID:FBgn0039726 Length:306 Species:Drosophila melanogaster


Alignment Length:303 Identity:84/303 - (27%)
Similarity:131/303 - (43%) Gaps:55/303 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 IAFLHALRQVVHDFETPAKKEFGRSLDAAVKHHVDHLHKCRPLAVSVSNAYKQFKNQLTQLPADV 395
            ||.:..|..::.      ||:||..       |:.|        .::..|....:|....:.|.|
  Fly    31 IAAIRTLLMILE------KKQFGTI-------HILH--------TTMREAVAAMRNTDLSIAAIV 74

  Fly   396 PETESKELLVHFI-----DTYIE--NQI----GK--------AAQAISGFLQEKITDGDVLLTFA 441
               .:.||...||     |.::|  .||    ||        :.|.|:...|..||||..:||.:
  Fly    75 ---SAGELFCRFITLSLDDKHMEECRQIMLNRGKIFLTKLLNSRQVIAQQAQRFITDGCRILTHS 136

  Fly   442 CSSLIQFICEEAKRRQVAFRVIVVDSRPGCEGQELLRRLHATGIPCTYVLINAVGYVMAEATKVL 506
            .|.::......|.:.:.:|.|.|.....|..|:|:::.|||.||.||.:|.:|.||||.....||
  Fly   137 RSRVVLKALITASQNKKSFHVYVTQGGTGNSGEEMVKDLHAAGIDCTLILDSATGYVMESVDFVL 201

  Fly   507 LGAHALLANGYVMARTGTAQVALVANAHNVPVLVCCETHKFSERFQTDAIVYNELSDPNQLVRGD 571
            :||.|::.:|.::.|.||..:.|.|.....|..|..|:.|||..:.     .|:...||:.    
  Fly   202 VGAEAVVESGGIINRIGTYTMGLCAREMKKPFYVLAESFKFSRLYP-----LNQRDLPNEY---- 257

  Fly   572 KCQLSNWAAKGKLLPLNLSYDITPPELVSAVVTEVAILPCTSV 614
            |....:.....|:.||   .|.|||..::.:.|::..|..::|
  Fly   258 KYSRKHLNDVSKVHPL---VDYTPPVYITLLFTDLGRLTPSAV 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2BdeltaNP_611790.1 GCD2 306..619 CDD:224105 84/303 (28%)
IF-2B 323..611 CDD:279362 83/298 (28%)
eIF2BalphaNP_651752.1 IF-2B 30..294 CDD:279362 83/298 (28%)
GCD2 31..305 CDD:224105 84/303 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451048
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1184
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.