DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2Bdelta and eIF2Bbeta

DIOPT Version :9

Sequence 1:NP_611790.1 Gene:eIF2Bdelta / 37706 FlyBaseID:FBgn0034858 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_570020.1 Gene:eIF2Bbeta / 31256 FlyBaseID:FBgn0024996 Length:352 Species:Drosophila melanogaster


Alignment Length:325 Identity:73/325 - (22%)
Similarity:138/325 - (42%) Gaps:39/325 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 LFNHLVCAKE----DS--QFINDPLVHPSIARLGVQYAKRTVVGSNARCIAFLHALRQVVHDFET 346
            :|.:::.:|.    |:  |.:.|     ....|.....:.||..:.||.|..|            
  Fly    34 IFKYIIMSKSWQNADALMQIVRD-----QCKILQAALPQETVTSNIARRILKL------------ 81

  Fly   347 PAKKEFGRSLDAAVKHHVDHLHKCRPLAVSVSNAYKQFKNQLTQLPADVPETESKELLVHFIDTY 411
             .::||. .|.|.|:|..|.    ...::|:.....|.......:...||:...:|.|:..:.. 
  Fly    82 -TREEFD-LLHAKVQHFADD----SQASLSLHKLVTQTSESNVSVDYSVPQHGLREALLDHLQE- 139

  Fly   412 IENQIGKAAQAISGFLQEKITDGDVLLTFACSSLIQFICEEAKRRQVAFRVIVVDSRPGCEGQEL 476
            :|.::..:::.|....:|.|...:::||...|..::...:.|.:::....:||.:..|.|.|..|
  Fly   140 VETELETSSENICVQAEEHIHSSEIILTLGHSRSVENFLKRAIKKRQFLTIIVAECAPACRGHNL 204

  Fly   477 LRRL-HATGIPCTYVLINAVGYVMAEATKVLLGAHALLANGYVMARTGTAQVALVANAHNVPVLV 540
            ...| :...:....:...|:..:|:...||::|.|::||||.:.|..|...|||.|..::|||:|
  Fly   205 AASLANEKNVEIVVIPDAAIFAMMSRVNKVIIGTHSVLANGGLRAACGAYTVALAAKHYSVPVIV 269

  Fly   541 CCETHKFSERFQTDAIVYNELSDPNQLVRGDKCQLSNWAAKGKLL-PLNLSYDITPPELVSAVVT 604
            ....:|.|.....:...:|.:.....::..|...    |.:.|:. |:   :|..|||||:..::
  Fly   270 LAPMYKLSPLHLCEQDAFNMVGCAEDVIPYDSIP----AREAKVYSPM---FDYVPPELVTLFIS 327

  Fly   605  604
              Fly   328  327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2BdeltaNP_611790.1 GCD2 306..619 CDD:224105 68/301 (23%)
IF-2B 323..611 CDD:279362 66/284 (23%)
eIF2BbetaNP_570020.1 GCD2 8..345 CDD:275543 73/325 (22%)
IF-2B 21..334 CDD:279362 73/325 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451046
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1184
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.