DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF2Bdelta and Eif2b1

DIOPT Version :9

Sequence 1:NP_611790.1 Gene:eIF2Bdelta / 37706 FlyBaseID:FBgn0034858 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_663346.1 Gene:Eif2b1 / 209354 MGIID:2384802 Length:305 Species:Mus musculus


Alignment Length:326 Identity:79/326 - (24%)
Similarity:135/326 - (41%) Gaps:63/326 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 VQYAKRTVVG--SNARCIAFLHALRQVVHDFETPAKKEFGRSLDAAVKHHVDHLHKCRPLAVSVS 378
            ::|.|..:.|  ..|..:|.:..|.:.:       |::.|.:|..              |..:::
Mouse     7 IEYFKSQMKGDPKMASAVAAIQTLLEFL-------KRDKGETLQG--------------LRANLT 50

  Fly   379 NAYKQFKNQLTQLPADVPETESKELLVHFID-TYIE-------------------NQIGKAAQAI 423
            .|.|    .|..:.:.|..:...||.:.||. |.:|                   .:|..:...|
Mouse    51 YAIK----TLCGVDSSVAVSSGGELFLRFISLTSLEYSDYSKCKKIMIERGELFLRRISLSRNKI 111

  Fly   424 SGFLQEKITDGDVLLTFACSSLIQFICEEAKRRQVAFRVIVVDSRPGCEGQELLRRLHATGIPCT 488
            :......|.||..:||.|.|.::..:.|||...:..|.|.:.:|:|...|:::.:.|....:|.|
Mouse   112 ANLCHTFIKDGARILTHAYSRVVLRVLEEAVAAKKRFSVYITESQPDLSGKKMAKALSHLNVPVT 176

  Fly   489 YVLINAVGYVMAEATKVLLGAHALLANGYVMARTGTAQVALVANAHNVPVLVCCETHKFSERFQT 553
            .||..||||:|.:|..|::||..::.||.::.:.||.|:|:.|.|.|.|..|..|:.||...|..
Mouse   177 VVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPL 241

  Fly   554 DAIVYNELSDPNQLVRGDKCQLSNWAAKGKLLPLNLS-----YDITPPELVSAVVTEVAILPCTS 613
                       ||....||.:......|......:|.     .|.|.|.|::.:.|::.:|..::
Mouse   242 -----------NQEDVPDKFKYKADTLKSVQTGQDLKEEHPWVDYTSPSLITLLFTDLGVLTPSA 295

  Fly   614 V 614
            |
Mouse   296 V 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF2BdeltaNP_611790.1 GCD2 306..619 CDD:224105 79/326 (24%)
IF-2B 323..611 CDD:279362 76/314 (24%)
Eif2b1NP_663346.1 GCD2 5..305 CDD:224105 79/326 (24%)
IF-2B 17..293 CDD:279362 75/311 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.