DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and zgc:123295

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:288 Identity:85/288 - (29%)
Similarity:129/288 - (44%) Gaps:71/288 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CG----TTKPEFIPMITGGADAGLFSNPWMVKV----LGEKLCGGSLITSRFVLTAAHCI---VS 83
            ||    .||      |.||.:||..|.||.|.:    .|...||||||...:||:||||.   :.
Zfish    27 CGRAPLNTK------IVGGQNAGAGSWPWQVSLQSPTYGGHFCGGSLINKDWVLSAAHCFQDSIG 85

  Fly    84 THMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYELAVDRKILHADY 148
            |.| |:||..         |:.....|::.:                       .|.:.|.|.:|
Zfish    86 TIM-VKLGLQ---------SQSGSNPYQITK-----------------------TVVQVINHPNY 117

  Fly   149 -NLNLDNDIGLLRMKSFVQYSDYVRPICLLVEGH-MAESPIFNITGWGVTNDGTPS-----RRLQ 206
             |.:.||||.|:::.|.|.::||:.|:||...|: .|...:..:||||..:.....     :.::
Zfish   118 NNPSNDNDIALVKLDSSVTFNDYIEPVCLAAAGNTYAAGTLSWVTGWGKLSSAANQIPDILQEVE 182

  Fly   207 RATVYNTDLHFCRSKFTKQVDESQICAA---GTNSDACHGDSGGPLSAQVPFAGS-WLTFQYGLV 267
            ...|.::|   |:..:..::..:.|||.   ....|:|.||||||:   |...|| |:  |.|:|
Zfish   183 IPIVSHSD---CKRAYPGEITSNMICAGLLDQGGKDSCQGDSGGPM---VSRNGSQWI--QSGIV 239

  Fly   268 SYGSAACHSF--SVYTNVTHHRDWIVNA 293
            |:|.......  .||..|:.::|||.::
Zfish   240 SFGRGCAEPGYPGVYARVSQYQDWITSS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 79/268 (29%)
Tryp_SPc 41..290 CDD:238113 79/268 (29%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 80/275 (29%)
Tryp_SPc 36..264 CDD:238113 79/268 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.