DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG34458

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:259 Identity:66/259 - (25%)
Similarity:105/259 - (40%) Gaps:48/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ITGG--ADAGLFSNPWMVKVLGEKLCGGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCS 103
            |.||  |..|.|.:...:::.|...||||||:...::|||||.:..:.    |:.|......|.|
  Fly    32 IIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDTMIVTAAHCTMGQNP----GQMKAIVGTNDLS 92

  Fly   104 RCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYELAVDRKILHADYN-LNLDNDIGLLRMKSFVQY 167
            ....:::.:.:.                           |:|..|| .:.|.|:.|:::.|.|..
  Fly    93 AGNGQTFNIAQF---------------------------IIHPRYNPQSQDFDMSLIKLSSPVPM 130

  Fly   168 SDYVRPICLL-VEGHMAESPIFNITGWGVTNDGTP-SRRLQRATVYNTDLHFCRSKFTKQVDESQ 230
            ...|:.|.|. .:.:.|...:..|:|:|..|.... ..||:.|.|......:|.|:....:.:..
  Fly   131 GGAVQTIQLADSDSNYAADTMAMISGFGAINQNLQLPNRLKFAQVQLWSRDYCNSQNIPGLTDRM 195

  Fly   231 ICAAGTNS--DACHGDSGGPLSAQVPFAG--SWLTFQYGLVSYGSAACHSFSVYTNVTHHRDWI 290
            :||...:.  .:|.|||||||:......|  ||        .:|..|....::||.|...|.||
  Fly   196 VCAGHPSGQVSSCQGDSGGPLTVDGKLFGVVSW--------GFGCGAKGRPAMYTYVGALRSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 64/257 (25%)
Tryp_SPc 41..290 CDD:238113 64/257 (25%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 64/257 (25%)
Tryp_SPc 32..254 CDD:238113 66/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.