DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:297 Identity:93/297 - (31%)
Similarity:128/297 - (43%) Gaps:75/297 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CGTTKPEFIPMITGGADAGLFSNPWMVKVLGE--KLCGGSLITSRFVLTAAHCIVS---THMRVR 89
            ||...|...|.|.||.:|...:.||||.:.|.  ..||||||.:::|||||||||.   :.:.|.
Zfish    25 CGRPNPTLNPRIVGGVNATHGAWPWMVSLQGRYGHFCGGSLINNQWVLTAAHCIVDQTPSSIIVY 89

  Fly    90 LGEYKTRFPG-KDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYELAVDRKILHADY-NLNL 152
            ||::::.... ...||.:      |.|                           |.|..| |:..
Zfish    90 LGKWRSYVADVNSISRTI------RHI---------------------------IPHPSYSNITK 121

  Fly   153 DNDIGLLRMKSFVQYSDYVRPICLLVE-GHMAESPIFNITGWG----VTNDGTPSRR-------- 204
            ||||.||::.|.|||:||::||||..| .:........:.|||    :...|...|.        
Zfish   122 DNDIALLQLTSTVQYTDYIKPICLADENSNFPRGTNSWVAGWGDIGVLGTGGIRGRTTVSVPLPH 186

  Fly   205 ---LQRA--TVY-NTDL-HFCRSKFTKQVDESQICAAGT---NSDACHGDSGGPLSAQVPFAGSW 259
               ||.|  .|| |.|. :.|..:.|    .:.|| |||   ......|||||||..:   ...|
Zfish   187 PGILQEAELKVYSNADCNNICHGRIT----PNMIC-AGTRPGGKATFSGDSGGPLMTK---CSVW 243

  Fly   260 LTFQYGLVS--YGSAACHSFSVYTNVTHHRDWIVNAI 294
            :  |.|::|  ||.|..:...|:..|:.::.||...:
Zfish   244 V--QAGVLSHGYGCAQPNLPEVFIRVSEYKQWITGNV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 87/280 (31%)
Tryp_SPc 41..290 CDD:238113 87/280 (31%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 87/280 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.