DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and hgfa

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_005164799.1 Gene:hgfa / 493781 ZFINID:ZDB-GENE-041014-2 Length:712 Species:Danio rerio


Alignment Length:301 Identity:72/301 - (23%)
Similarity:106/301 - (35%) Gaps:90/301 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GTTKPE-FI---PMITGG-----ADAGLFSNPWMVKVL--GEKLCGGSLITSRFVLTAAHCIVST 84
            |..||. ||   ..|.||     |:.|    .|:|.:.  ....||||||...:|||...|.   
Zfish   463 GGPKPSCFIHKTTRIVGGMRVQRAEDG----SWVVSIQKGNRHWCGGSLIREEWVLTDQQCF--- 520

  Fly    85 HMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYELAVDRKILHADYN 149
                              |.|||.        |.||                 .|...:||.:.:
Zfish   521 ------------------STCVPD--------LSEY-----------------TVQVGLLHLNAS 542

  Fly   150 LNLD-------------NDIGLLRMKSFVQYSDYVRPICLLVEG-HMAESPIFNITGWGVTNDGT 200
            ....             :::.||::.:....|::||.:.|.|.| .:||..:..:.|||.|. ||
Zfish   543 AGTQALRIAHVVCGPEGSNLALLKLTTPAPLSEHVRTVQLPVAGCAVAEGTLCLMYGWGDTK-GT 606

  Fly   201 PSRRLQRATVYNTDLHFCRSKFTKQ-------VDESQICAAG-TNSDACHGDSGGPLSAQVPFAG 257
            .    ...::....|....:|...|       :.|::|||.| .:...|..|.||||..|.  ..
Zfish   607 G----HEGSLKMVGLPIVSNKRCSQSHNGILPITETKICAGGKRDQGVCEKDYGGPLVCQE--GE 665

  Fly   258 SWLTFQYGLVSYGSAACHSFSVYTNVTHHRDWIVNAIEDFS 298
            |.:.....:...|.|.....:|:.||..:.:||....:.:|
Zfish   666 SKVIVGVSINGRGCAVARRPAVFVNVAFYSEWIRKVFKYYS 706

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 64/277 (23%)
Tryp_SPc 41..290 CDD:238113 64/277 (23%)
hgfaXP_005164799.1 PAN_AP_HGF <50..107 CDD:238532
KR 111..192 CDD:238056
KR 195..275 CDD:214527
KR 287..367 CDD:214527
KR 374..451 CDD:214527
Tryp_SPc 476..698 CDD:214473 64/278 (23%)
Tryp_SPc 477..701 CDD:238113 66/280 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575861
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.