DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and MST1

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001380510.1 Gene:MST1 / 4485 HGNCID:7380 Length:737 Species:Homo sapiens


Alignment Length:249 Identity:67/249 - (26%)
Similarity:96/249 - (38%) Gaps:65/249 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GEKLCGGSLITSRFVLTAAHCIVSTHM-----RVRLGE-YKTRFPGKDCSRCVPKSYKLRRIRLG 118
            |:..|||||:..:::|||..|..|.||     .|.||. ::....|:...:.||.:         
Human   529 GQHFCGGSLVKEQWILTARQCFSSCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVA--------- 584

  Fly   119 EYDTRFPGKDCCVPKSYELAVDRKILHADYNLNLDNDIGLLRMKSFVQYSDYVRPICLLVEGHMA 183
                    |..|.|...:|.                   ||:::..|..:..|..|||..|.::.
Human   585 --------KMVCGPSGSQLV-------------------LLKLERSVTLNQRVALICLPPEWYVV 622

  Fly   184 -ESPIFNITGWGVTNDGTPSRRLQRATVYNTDL------HFCRSKFTKQVDESQICAAGTNS--D 239
             ......|.|||.|. ||.:     .||.|..|      ..|..|...:|.||::|..|..:  .
Human   623 PPGTKCEIAGWGETK-GTGN-----DTVLNVALLNVISNQECNIKHRGRVRESEMCTEGLLAPVG 681

  Fly   240 ACHGDSGGPLSAQVPFA-GSWLTFQYGLVSYGSAACHSF--SVYTNVTHHRDWI 290
            ||.||.||||:.   |. ..|:.  .|::........|.  :|:|.|:...|||
Human   682 ACEGDYGGPLAC---FTHNCWVL--EGIIIPNRVCARSRWPAVFTRVSVFVDWI 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 65/247 (26%)
Tryp_SPc 41..290 CDD:238113 65/247 (26%)
MST1NP_001380510.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143026
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.