DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG16710

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:316 Identity:99/316 - (31%)
Similarity:152/316 - (48%) Gaps:66/316 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLVCSIQLGEGAPGHLLDSS--CGTTKPEFIPMITGGADAGLFSNPWMVKVL---------GEKL 63
            :|:|...:     ||:|.::  ||...|.:  .|.||.:......|||..:|         .|:|
  Fly    80 VLICCPNM-----GHILPNTQICGPIMPAY--RIFGGEETQPNELPWMALILYAHRSRSVWNERL 137

  Fly    64 ---CGGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYD---- 121
               |.|||||:|:|||||||:              |..|.|          |||:||||::    
  Fly   138 VSRCAGSLITNRYVLTAAHCL--------------RITGLD----------LRRVRLGEHNILSN 178

  Fly   122 ----TRFPGKDCCVPKSYELAVDRKILHADYNLNLD---NDIGLLRMKSFVQYSDYVRPICLLVE 179
                |...|::.|.|:..|:.||..|.|..|.:..:   |||.|||:|..|:|:..::|||:.::
  Fly   179 PDCVTHINGREHCAPEHLEIDVDLSIKHRHYMVFEERPYNDIALLRLKFPVRYTAQIKPICVQLD 243

  Fly   180 GHMAESPIFN-----ITGWGVTNDGTPSRRLQRATVYNTDLHFCR-SKFTKQVD-ESQICAAGT- 236
             ::..:|.|:     |.|||:::....|..|.:|.|...:...|. |:.:..:| |:.|||... 
  Fly   244 -YIFSNPSFSNHKLQIAGWGLSHKQGYSNVLLQAYVNGRNADECSLSEPSLGLDKETHICAGNLG 307

  Fly   237 NSDACHGDSGGPLSAQVPFAGSWLTFQYGLVSYGSAAC-HSFSVYTNVTHHRDWIV 291
            .:|.|.|||||||.|.:........:..|:.|||.:.| :..:.||..:...:||:
  Fly   308 GNDTCKGDSGGPLMAIMERGDEEFVYLAGITSYGYSQCGYGPAAYTKTSKFVEWIL 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 89/280 (32%)
Tryp_SPc 41..290 CDD:238113 89/280 (32%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855 1/3 (33%)
Tryp_SPc 105..362 CDD:214473 89/281 (32%)
Tryp_SPc 106..362 CDD:238113 89/280 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.