DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG31266

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:311 Identity:79/311 - (25%)
Similarity:116/311 - (37%) Gaps:71/311 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAAGLALLVCSIQ--------LGEGAPGHLLDSSCGTTKPEFIPM--ITGGADAGLFSNPWMVKV 58
            :..||.||  ::|        .||..||  |.:.......|.:|.  :.||..|...:.||:..:
  Fly     9 VLLGLTLL--ALQGPTEAMRMRGEPLPG--LANIERHRSTEAVPQGRVIGGTTAAEGNWPWIASI 69

  Fly    59 ---LGEKLCGGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEY 120
               ....|||..::...:|||||.|:..                            ||.:.|...
  Fly    70 QNAYSYHLCGAIILDETWVLTAASCVAG----------------------------LRPLNLLVV 106

  Fly   121 DTRFPGKDCCVPKSYELAVDRKILHADYNLNL-DNDIGLLRMKSFVQYSDYVRPICLLVEGHMAE 184
            .......|...|   ...|.:..:|.:::..| .|||.||::.|.::::|..:.|.|.....:.|
  Fly   107 TGTVDWWDLYAP---YYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEE 168

  Fly   185 SPIFNITGWGVTND-GTPSRRLQRATVYNTDLHFCRSKFTKQ--VDESQICA---AGTNSDACHG 243
            .......|||.:.. ||..|.||.|:.....:..||.|...|  ||...:|.   ||  ..||||
  Fly   169 GDKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAG--QGACHG 231

  Fly   244 DSGGPL---SAQVPFAGSWLTFQYGLVSYGSAACHSF-SVYTNVTHHRDWI 290
            |:||||   ..::...|:|          |......: .||.....:.|||
  Fly   232 DTGGPLIDEQQRLVGIGNW----------GVPCGRGYPDVYARTAFYHDWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 65/262 (25%)
Tryp_SPc 41..290 CDD:238113 65/262 (25%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 65/263 (25%)
Tryp_SPc 52..275 CDD:238113 67/264 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.