DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG14892

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster


Alignment Length:406 Identity:78/406 - (19%)
Similarity:124/406 - (30%) Gaps:171/406 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DSSCGTTKPEFIPMITGGADAGLFSNPWMVKV---------LGEKLCGGSLITSRFVLTAAHCIV 82
            ::.||.......|.|..||.......||...:         ||. .||..||...::|:||||:.
  Fly    67 ETDCGCRPARRGPRIIAGAATNEGQFPWQASLELLHPSLGFLGH-WCGAVLIHQYWILSAAHCVH 130

  Fly    83 STHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYELAVDRKILHAD 147
            :....:.:....|                   :.|||:|     :|........:.|::.::|..
  Fly   131 NDLFNLPIPPLWT-------------------VVLGEHD-----RDVESGNEQRIPVEKIVMHHR 171

  Fly   148 YNLNLDNDIGLLRMK--SFVQYSDYVRPICLLVEGHMAESP------------------------ 186
            |: |..:|:.|:::.  :.:..:..:|.|||  ...:||||                        
  Fly   172 YH-NFKHDVVLMKLSKPADLTRASNIRRICL--PFLLAESPDQAQSETVSPPSSADEDVLIQQLE 233

  Fly   187 -------------------------------IFNI------------------------------ 190
                                           :.|:                              
  Fly   234 LEDVPEKIDNFLRSVQSRRRYRNVTAPSMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMK 298

  Fly   191 --------------------------------TGWGVTN-DGTPSRRLQRATVYNTDLH---FCR 219
                                            ||||..| .|..|.:|.:..|   .||   .||
  Fly   299 LGPRRDSDDSAEQKHPKVSDEPKEIAFVDCVATGWGKANISGDLSNQLLKTQV---PLHQNGRCR 360

  Fly   220 SKFTK--QVDESQICAAGTNSD--ACHGDSGGPLSAQVPFAGSWLTFQYGLVSYGS-AACHSF-S 278
            ..:..  .:....:||...|.:  .|.|||||||..::...|.|:.  .|:.|:|| .|...| .
  Fly   361 DAYGSFVNIHGGHLCAGKLNGEGGTCVGDSGGPLQCRLSRDGPWIL--VGVTSFGSGCALEGFPD 423

  Fly   279 VYTNVTHHRDWIVNAI 294
            |||..:::..||.:.|
  Fly   424 VYTRTSYYMKWIEDTI 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 72/386 (19%)
Tryp_SPc 41..290 CDD:238113 72/386 (19%)
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 72/387 (19%)
Tryp_SPc 81..438 CDD:238113 74/389 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.