DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG8870

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:301 Identity:94/301 - (31%)
Similarity:136/301 - (45%) Gaps:58/301 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 HLLDSSCGTT--KPEFIPMITGGADAGLFSNPWMVKV-------LGEKL---CGGSLITSRFVLT 76
            :|...:||.:  ||      |.|....|...|||..:       |.:||   ||||||.:.:|||
  Fly    71 YLPHDTCGQSRRKP------TKGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLT 129

  Fly    77 AAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTR-------FPGKDCCVPKS 134
            ||||:              .:|..|      ..|.|:.:||||::|.       ..|:....|..
  Fly   130 AAHCV--------------EYPFMD------YPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLY 174

  Fly   135 YELAVDRKILHADYN--LNLDNDIGLLRMKSFVQYSDYVRPICL-LVEGHMAESPIFNITGWGVT 196
            .|:.||:.|.|..:|  ..|.|||.|:|:|..|:|:..::|||| ..:...|....|..:||...
  Fly   175 MEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQASGWPDM 239

  Fly   197 NDGTPSRRLQRATVYNTDLHFCRSKFTKQVDESQICAAGTN-SDACHGDSGGPLSAQVPFAGSWL 260
            ..|..|..|.|:.:.......|:|.:...:. |||||.|.: :|...|||||||...|......|
  Fly   240 GQGIASEVLLRSFIAERHPDVCKSNYDFNLG-SQICAGGLDGNDTSPGDSGGPLMETVIRGKVTL 303

  Fly   261 TFQYGLVSYGSAAC------HSFSVYTNVTHHRDWIVNAIE 295
            |:..|::|||...|      .:|  ||..::..:||.:.::
  Fly   304 TYAAGIISYGQKPCVLKTCKPAF--YTKTSYFFEWIKSKLQ 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 87/275 (32%)
Tryp_SPc 41..290 CDD:238113 87/275 (32%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 86/269 (32%)
Tryp_SPc 93..337 CDD:214473 84/266 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.