DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG3916

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:251 Identity:72/251 - (28%)
Similarity:108/251 - (43%) Gaps:62/251 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 EKLCGGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCV-PKSYKLRRIRLGEYDTRF 124
            :..||||:::.:.|||||||:  ..|:|           :|.|..| ..::|...:|        
  Fly    56 QHFCGGSIVSGQHVLTAAHCM--EKMKV-----------EDVSVVVGTLNWKAGGLR-------- 99

  Fly   125 PGKDCCVPKSYELAVDRKILHADYNLN--LDNDIGLLRMKS--FVQYSDYVRPICLLVEGHMAES 185
                      :.|..  |.:|..|::|  :.|||.|:::..  .::.|| :..|.:.....:.|.
  Fly   100 ----------HRLVT--KHVHPQYSMNPRIINDIALVKVTPPFRLERSD-ISTILIGGSDRIGEK 151

  Fly   186 PIFNITGWGVTNDGTPS-------RRLQRATVYNTDLHFCRSKFTKQVDESQICA-AGTNSDACH 242
            ....:||||.|:..|.|       :.|...|:.|.|   |..|..: |..::||| |.....||.
  Fly   152 VPVRLTGWGSTSPSTSSATLPDQLQALNYRTISNED---CNQKGFR-VTRNEICALAVQGQGACV 212

  Fly   243 GDSGGPL--SAQVPFAGSWLTFQYGLVSYGSAACHSF--SVYTNVTHHRDWIVNAI 294
            |||||||  ..:.|..       .|:|||||:.|...  .|||.|:....:|...|
  Fly   213 GDSGGPLIRPGKQPHL-------VGIVSYGSSTCAQGRPDVYTRVSSFLPYISQVI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 70/245 (29%)
Tryp_SPc 41..290 CDD:238113 70/245 (29%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 70/245 (29%)
Tryp_SPc 31..260 CDD:238113 71/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.