DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and Prss45

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001008864.1 Gene:Prss45 / 408244 RGDID:1303021 Length:330 Species:Rattus norvegicus


Alignment Length:282 Identity:75/282 - (26%)
Similarity:117/282 - (41%) Gaps:73/282 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PWMV--KVLGEKLCGGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRI 115
            ||.|  ::..|.:|||:||...:|::|||||...                       |.|   .:
  Rat    62 PWEVSLQIENEHVCGGALIDQSWVVSAAHCIQGN-----------------------KEY---LV 100

  Fly   116 RLGEYDTRFPGKDCCVPKSYELAVDRKILHADY---NLNLDNDIGLLRMKSFVQYSDYVRPICLL 177
            .||....:..|.    |.:.::.|...|:|..|   |. :.:||.||.:::.|.::.|::||||.
  Rat   101 MLGSSTLQPSGS----PWALKIPVGDIIMHPKYWGQNF-IRSDIALLCLETPVTFNKYIQPICLP 160

  Fly   178 VEGHMAESPIFN--------ITGWGVTNDGTPSRRLQRATVY-----------NTDLHFCRSKFT 223
            ...       ||        :||||.... .||.:|.|:...           |.|..|.:..|.
  Rat   161 EHN-------FNLKVGMKCWVTGWGQAKQ-HPSAKLTRSLELWEAEVSIVDNKNCDRVFHKKTFY 217

  Fly   224 KQV----DESQICAAGTNSDACHGDSGGPLSAQVPFAGSWLTFQYGLVSYGSAA--CHSFSVYTN 282
            .||    .::.||......:.|:||.||||:.:|  .|.|:.  .|:.|:..|.  ..:.||||.
  Rat   218 PQVIPLIRKNMICTTNHRENPCYGDPGGPLACEV--HGRWIL--AGIFSWEKACTKAPNLSVYTR 278

  Fly   283 VTHHRDWIVNAIEDFSRAFQLR 304
            :..:..||...:...:|:.:.|
  Rat   279 IDKYTGWIKEQVSRGARSGRCR 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 71/266 (27%)
Tryp_SPc 41..290 CDD:238113 71/266 (27%)
Prss45NP_001008864.1 Tryp_SPc 57..289 CDD:238113 73/269 (27%)
Tryp_SPc 57..286 CDD:214473 71/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336748
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.