DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and MP1

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:314 Identity:97/314 - (30%)
Similarity:132/314 - (42%) Gaps:78/314 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TTKP------EFIPM-----------ITGGADAGLFSNPWMV--------KVLGEKLCGGSLITS 71
            ||||      :.:||           :.||.:......|||.        .|.|.. ||||||..
  Fly   112 TTKPTKRSGTKLLPMAPNCGENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHH-CGGSLINH 175

  Fly    72 RFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKS-- 134
            |:|||||||:                      ..:|..::|..:||||:|.. ...||.|.|:  
  Fly   176 RYVLTAAHCV----------------------SAIPSDWELTGVRLGEWDAS-TNPDCTVGKNGR 217

  Fly   135 -------YELAVDRKILHADYNLNLD---NDIGLLRMKSFVQYSDYVRPICL--LVEGHMAESPI 187
                   .:..|:.:|.|..|..|..   |||.|||::..|||||::.|:||  |...|   :.|
  Fly   218 RDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQYSDFILPVCLPTLASQH---NNI 279

  Fly   188 F-----NITGWGVTNDGTPSRRLQRATVYNTDLHFCRSKFTKQ---VDESQICAAGTNS-DACHG 243
            |     .:.|||.|.....|....:|.:.......|..::..|   |...|:||.|... |:|.|
  Fly   280 FLGRKVVVAGWGRTETNFTSNIKLKAELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGVDSCRG 344

  Fly   244 DSGGPLSAQVPFAGSWLTFQYGLVSYGSAACHSF---SVYTNVTHHRDWIVNAI 294
            ||||||..:....|:...:..|:||||...|...   .|||.|..:.:||.|.:
  Fly   345 DSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWIENNV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 88/282 (31%)
Tryp_SPc 41..290 CDD:238113 88/282 (31%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 88/283 (31%)
Tryp_SPc 138..397 CDD:238113 90/285 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.