DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG6865

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:316 Identity:87/316 - (27%)
Similarity:141/316 - (44%) Gaps:62/316 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FIAAGLALLVCSIQLGEGAPGHLLDSS--CGTTKPEFIPMITGGADAGLFSNPWMVKVL--GEKL 63
            |:.|.|:|:.|       |...:..|:  |....|:    |.||::|.....|:||.::  |...
  Fly     6 FVVAVLSLVKC-------AQSQIAFSNQPCSVRNPK----IVGGSEAERNEMPYMVSLMRRGGHF 59

  Fly    64 CGGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRF-PGK 127
            |||::|:.|::|||.|||.:       |..:...|.:     :.....|..||  ||.... .|.
  Fly    60 CGGTIISERWILTAGHCICN-------GLQQFMKPAQ-----IQGVVGLHSIR--EYLNGIGNGP 110

  Fly   128 DCCVPKSYELAVDRK--ILHADYNLN-LDNDIGLLRMKSFVQYSDYVRPICL-LVEGHMA-ESPI 187
            |.       |.||.|  :.|..|:.| :.:||.||.:...:::|.:::|.|: ..|||.: |...
  Fly   111 DA-------LRVDFKNIVPHPQYDCNDVKHDIALLELVQPIRFSSHIQPSCVGSEEGHRSLEQEY 168

  Fly   188 FNITGWGVTNDGTP----SRRLQRATVYNTDLHFCRSKF-----TKQVDESQICAAGTNS--DAC 241
            ..::|||.|::...    |..|::|||...:...|...:     :..:.|:|:||...|.  |:|
  Fly   169 GTVSGWGWTHENQAENDRSDVLRKATVKIWNNEACERSYRSLGKSNTIGETQLCAGYENGQIDSC 233

  Fly   242 HGDSGGPLSAQVPFAGSWLTFQYGLVSYGSAACHSF--SVYTNVTHHRDWIVNAIE 295
            ..||||||.::....       .|:||.|.......  .:||.|:.:..|:...|:
  Fly   234 WADSGGPLMSKEHHL-------VGVVSTGIGCARPGLPGIYTRVSKYVSWMQKVID 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 76/269 (28%)
Tryp_SPc 41..290 CDD:238113 76/269 (28%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 76/273 (28%)
Tryp_SPc 35..280 CDD:238113 77/272 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.