DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG4613

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster


Alignment Length:293 Identity:83/293 - (28%)
Similarity:127/293 - (43%) Gaps:63/293 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GEGAPGHLLD--SSCGTTKPEFIPMITGGADAGLFSNPWMVKVL-GEKL-CGGSLITSRFVLTAA 78
            |.||....::  :||....|. :..|.||........||:.::: |..| |||:||..|:|||||
  Fly   113 GGGAKAFRVNRCASCTCGVPN-VNRIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAA 176

  Fly    79 HCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYELAVDRKI 143
            ||:....||                     ...:|.::|....|             .|.|.|.:
  Fly   177 HCVHGMDMR---------------------GVSVRLLQLDRSST-------------HLGVTRSV 207

  Fly   144 ----LHADYN-LNLDNDIGLLRMKSFVQYSDYVRPICLLVEGHMAESPIFN---ITGWGVTND-G 199
                .|..|: ::|.:||.|||:...:...|.:||.||  ..:..::..|.   :.|||::.: |
  Fly   208 AFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACL--PSNWLQNFDFQKAIVAGWGLSQEGG 270

  Fly   200 TPSRRLQRATVYNTDLHFCR-SKFTKQVDESQICAAGTNS---DACHGDSGGPLSAQVPFAGSWL 260
            :.|..||...|.......|| :.:...:.::.:||....:   |||.|||||||..:...     
  Fly   271 STSSVLQEVVVPIITNAQCRATSYRSMIVDTMMCAGYVKTGGRDACQGDSGGPLIVRDRI----- 330

  Fly   261 TFQY-GLVS--YGSAACHSFSVYTNVTHHRDWI 290
             |:. |:||  ||.|...:..|||.|:.:.:||
  Fly   331 -FRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 75/266 (28%)
Tryp_SPc 41..290 CDD:238113 75/266 (28%)
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 75/267 (28%)
Tryp_SPc 137..362 CDD:238113 75/266 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.