DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG30283

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:303 Identity:104/303 - (34%)
Similarity:156/303 - (51%) Gaps:61/303 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LALLVCS--IQLGEGAPGHLLDSSCGTTKPEFIPM----ITGGADAGLFSNPWMVKVLGEK--LC 64
            :.||..|  :.||..: |..|:..|||     :|:    |.||.:|.:.|.|||..|:||.  .|
  Fly    10 VVLLAASSVVVLGSES-GSFLEHPCGT-----VPISQFKILGGHNAPVASAPWMAMVMGEGGFHC 68

  Fly    65 GGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDC 129
            ||:|||:|||||:||||.:..::||||..:..                                 
  Fly    69 GGTLITNRFVLTSAHCIANGELKVRLGVLERE--------------------------------- 100

  Fly   130 CVPKSYELAVDRKILHADYNLNLDNDIGLLRMKSFVQYSDYVRPICLL-------VEGHMAESPI 187
              .::.:.|||...:|.||..: .:|:.|||:...|.|||.:.|||||       ::.|:.:   
  Fly   101 --AEAQKFAVDAMFVHTDYYFD-QHDLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVK--- 159

  Fly   188 FNITGWGVTNDGTPSRRLQRATVYNTDLHFCRSKFT-KQVDESQICAAGTNSDACHGDSGGPLSA 251
            |...|||.|...:.||.||:.:::|.....|..::. :|::.:.|||...|::.|:|||||||:|
  Fly   160 FRTYGWGKTESRSSSRMLQKTSLFNLHRSECAKQYPHQQINRNHICAESANANTCNGDSGGPLTA 224

  Fly   252 QVPFAGSWLTFQYGLVSYGSAACHSFSVYTNVTHHRDWIVNAI 294
            .|.:....:.||:|:.|:|.|.|...:|:|||..|.|||||.:
  Fly   225 IVTYDHVQMVFQFGVTSFGHADCSKATVFTNVMTHLDWIVNTV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 89/258 (34%)
Tryp_SPc 41..290 CDD:238113 89/258 (34%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 89/259 (34%)
Tryp_SPc 43..266 CDD:238113 92/261 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472840
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.980

Return to query results.
Submit another query.